Chlorocebus sabaeus (green monkey): 103243719 Help Entry 103243719         CDS       T04361                                  Symbol ACTG1 Name (RefSeq) actin gamma 1   KO K05692   actin beta/gamma 1 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab03082   ATP-dependent chromatin remodeling csab04015   Rap1 signaling pathway csab04145   Phagosome csab04210   Apoptosis csab04390   Hippo signaling pathway csab04510   Focal adhesion csab04520   Adherens junction csab04530   Tight junction csab04611   Platelet activation csab04613   Neutrophil extracellular trap formation csab04670   Leukocyte transendothelial migration csab04714   Thermogenesis csab04810   Regulation of actin cytoskeleton csab04814   Motor proteins csab04820   Cytoskeleton in muscle cells csab04919   Thyroid hormone signaling pathway csab04921   Oxytocin signaling pathway csab04971   Gastric acid secretion csab05014   Amyotrophic lateral sclerosis csab05100   Bacterial invasion of epithelial cells csab05132   Salmonella infection csab05135   Yersinia infection csab05164   Influenza A csab05205   Proteoglycans in cancer csab05225   Hepatocellular carcinoma csab05410   Hypertrophic cardiomyopathy csab05412   Arrhythmogenic right ventricular cardiomyopathy csab05414   Dilated cardiomyopathy csab05416   Viral myocarditis csab05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:csab00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     103243719 (ACTG1)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     103243719 (ACTG1)    04390 Hippo signaling pathway     103243719 (ACTG1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     103243719 (ACTG1)   09143 Cell growth and death    04210 Apoptosis     103243719 (ACTG1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103243719 (ACTG1)    04520 Adherens junction     103243719 (ACTG1)    04530 Tight junction     103243719 (ACTG1)   09142 Cell motility    04814 Motor proteins     103243719 (ACTG1)    04820 Cytoskeleton in muscle cells     103243719 (ACTG1)    04810 Regulation of actin cytoskeleton     103243719 (ACTG1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     103243719 (ACTG1)    04613 Neutrophil extracellular trap formation     103243719 (ACTG1)    04670 Leukocyte transendothelial migration     103243719 (ACTG1)   09152 Endocrine system    04921 Oxytocin signaling pathway     103243719 (ACTG1)    04919 Thyroid hormone signaling pathway     103243719 (ACTG1)   09154 Digestive system    04971 Gastric acid secretion     103243719 (ACTG1)   09159 Environmental adaptation    04714 Thermogenesis     103243719 (ACTG1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     103243719 (ACTG1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     103243719 (ACTG1)   09172 Infectious disease: viral    05164 Influenza A     103243719 (ACTG1)   09171 Infectious disease: bacterial    05132 Salmonella infection     103243719 (ACTG1)    05135 Yersinia infection     103243719 (ACTG1)    05100 Bacterial invasion of epithelial cells     103243719 (ACTG1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     103243719 (ACTG1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103243719 (ACTG1)    05410 Hypertrophic cardiomyopathy     103243719 (ACTG1)    05412 Arrhythmogenic right ventricular cardiomyopathy     103243719 (ACTG1)    05414 Dilated cardiomyopathy     103243719 (ACTG1)    05416 Viral myocarditis     103243719 (ACTG1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:csab03021]     103243719 (ACTG1)    03019 Messenger RNA biogenesis [BR:csab03019]     103243719 (ACTG1)    03036 Chromosome and associated proteins [BR:csab03036]     103243719 (ACTG1)    03029 Mitochondrial biogenesis [BR:csab03029]     103243719 (ACTG1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:csab04812]     103243719 (ACTG1)    04147 Exosome [BR:csab04147]     103243719 (ACTG1) Transcription machinery [BR:csab03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      103243719 (ACTG1) Messenger RNA biogenesis [BR:csab03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      103243719 (ACTG1) Chromosome and associated proteins [BR:csab03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      103243719 (ACTG1)     NuA4 complex      103243719 (ACTG1)   Chromatin remodeling factors    BAF complex     103243719 (ACTG1)    PBAF complex     103243719 (ACTG1)    GBAF(ncBAF) complex     103243719 (ACTG1)    SWR1 complex     103243719 (ACTG1) Mitochondrial biogenesis [BR:csab03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     103243719 (ACTG1) Cytoskeleton proteins [BR:csab04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      103243719 (ACTG1) Exosome [BR:csab04147]  Exosomal proteins   Proteins found in most exosomes    103243719 (ACTG1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  103243719 NCBI-ProteinID:  XP_008011433 LinkDB All DBs Position 16:complement(73456907..73459777) Genome browser AA seq 375 aa AA seqDB search MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggaagaagagatcgccgcgctcgtcattgataatggctccggcatgtgcaaagctggc tttgctggggacgatgcaccccgagccgtgtttccctccatcgtcgggcgcccccgacac cagggcgtgatggtgggcatgggccagaaggactcctacgtgggtgacgaggcccagagc aagcgcggcatcttgaccctgaagtaccctatcgagcatggcattgtcactaactgggac gacatggagaaaatctggcaccatactttctacaatgagctgcgcgtggccccagaggag cacccggtgctgctgaccgaggcccctctgaaccctaaggccaacagagagaagatgact cagattatgtttgagaccttcaacaccccggccatgtacgtggccatccaggctgtgctg tccctctacgcctctgggcgcaccactggcattgtcatggactctggcgatggggtcacc cacacggtgcccatctatgagggctacgctctcccccacgccatcctgcgtctggacctg gctggccgggacctgactgactacctcatgaagattctcaccgagcgtggctacagcttc accaccacggccgagcgggaaattgtgcgtgacatcaaggagaagctgtgctacgtcgcc ctggacttcgagcaggagatggccaccgccgcatcgtcctcttccctggagaagagctat gagctgcctgatggtcaggtcatcaccatcggcaatgagaggttccggtgtccggaggcg ctgttccagccgtctttcctgggcatggaatcttgtggcatccacgagaccaccttcaac tctatcatgaagtgtgatgtggacatccgcaaagacctgtatgccaacacggtgctgtct ggcggcaccaccatgtacccaggcattgccgacaggatgcagaaggagatcactgccctg gcacccagcaccatgaagatcaagatcatcgcacccccagagcgcaagtactcagtgtgg atcggtggttccatcttggcctcactgtccaccttccagcagatgtggattagcaagcag gagtacgacgagtcgggcccctccatcgtccatcgcaaatgcttctaa

DBGET integrated database retrieval system