Chlorocebus sabaeus (green monkey): 103244520 Help Entry 103244520         CDS       T04361                                  Symbol IL4 Name (RefSeq) interleukin 4   KO K05430   interleukin 4 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04060   Cytokine-cytokine receptor interaction csab04151   PI3K-Akt signaling pathway csab04630   JAK-STAT signaling pathway csab04640   Hematopoietic cell lineage csab04657   IL-17 signaling pathway csab04658   Th1 and Th2 cell differentiation csab04659   Th17 cell differentiation csab04660   T cell receptor signaling pathway csab04664   Fc epsilon RI signaling pathway csab04672   Intestinal immune network for IgA production csab05140   Leishmaniasis csab05200   Pathways in cancer csab05310   Asthma csab05320   Autoimmune thyroid disease csab05321   Inflammatory bowel disease csab05330   Allograft rejection Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     103244520 (IL4)    04151 PI3K-Akt signaling pathway     103244520 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103244520 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     103244520 (IL4)    04660 T cell receptor signaling pathway     103244520 (IL4)    04658 Th1 and Th2 cell differentiation     103244520 (IL4)    04659 Th17 cell differentiation     103244520 (IL4)    04657 IL-17 signaling pathway     103244520 (IL4)    04664 Fc epsilon RI signaling pathway     103244520 (IL4)    04672 Intestinal immune network for IgA production     103244520 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103244520 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     103244520 (IL4)   09163 Immune disease    05310 Asthma     103244520 (IL4)    05320 Autoimmune thyroid disease     103244520 (IL4)    05321 Inflammatory bowel disease     103244520 (IL4)    05330 Allograft rejection     103244520 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csab04052]     103244520 (IL4)    00536 Glycosaminoglycan binding proteins [BR:csab00536]     103244520 (IL4) Cytokines and neuropeptides [BR:csab04052]  Cytokines   Interleukins    103244520 (IL4) Glycosaminoglycan binding proteins [BR:csab00536]  Heparan sulfate / Heparin   Cytokines    103244520 (IL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 Mannosyl_trans3 DUF1907 Motif Other DBs NCBI-GeneID:  103244520 NCBI-ProteinID:  XP_008012578 Ensembl:  ENSCSAG00000013765 UniProt:  A0A0D9RMS8 LinkDB All DBs Position 23:35492158..35501349 Genome browser AA seq 153 aa AA seqDB search MGLTSQLLPPLFFLLACAGNFVHGHNCHIALQEIIETLNSLTEQKTLCTKLTVTDILAAS KNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKKLIRFLKRLDRNLWGLAGL SSCPVKEASQSTLEDFLERLKTIMKEKYSKCRS NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccaactgcttccccctctgttcttcctgctagcatgtgccggcaac tttgtccacggacacaactgccatatcgctttacaggagatcatcgaaactctgaacagc ctcacagagcagaagactctgtgcaccaagttgaccgtaacggacatccttgctgcctcc aagaacacaactgagaaggaaaccttctgcagggctgcgaccgtgctccggcagttctac agccaccatgagaaggacactcgctgcctgggtgcaactgcacagcagttccacaggcac aagaagctgatccgattcctgaaacggctcgacaggaacctctggggcctggcgggcttg agctcctgtcctgtgaaggaagccagccagagtacgttggaagacttcttggaaaggcta aagacgatcatgaaagagaaatattcaaagtgtcggagctga

DBGET integrated database retrieval system