Chlorocebus sabaeus (green monkey): 103245758 Help Entry 103245758         CDS       T04361                                  Symbol FADD Name (RefSeq) Fas associated via death domain   KO K02373   FAS-associated death domain protein Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab01524   Platinum drug resistance csab04210   Apoptosis csab04215   Apoptosis - multiple species csab04217   Necroptosis csab04620   Toll-like receptor signaling pathway csab04621   NOD-like receptor signaling pathway csab04622   RIG-I-like receptor signaling pathway csab04623   Cytosolic DNA-sensing pathway csab04657   IL-17 signaling pathway csab04668   TNF signaling pathway csab04936   Alcoholic liver disease csab05010   Alzheimer disease csab05022   Pathways of neurodegeneration - multiple diseases csab05132   Salmonella infection csab05142   Chagas disease csab05152   Tuberculosis csab05160   Hepatitis C csab05161   Hepatitis B csab05162   Measles csab05163   Human cytomegalovirus infection csab05164   Influenza A csab05165   Human papillomavirus infection csab05167   Kaposi sarcoma-associated herpesvirus infection csab05168   Herpes simplex virus 1 infection csab05169   Epstein-Barr virus infection csab05170   Human immunodeficiency virus 1 infection csab05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     103245758 (FADD)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     103245758 (FADD)    04215 Apoptosis - multiple species     103245758 (FADD)    04217 Necroptosis     103245758 (FADD)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103245758 (FADD)    04621 NOD-like receptor signaling pathway     103245758 (FADD)    04622 RIG-I-like receptor signaling pathway     103245758 (FADD)    04623 Cytosolic DNA-sensing pathway     103245758 (FADD)    04657 IL-17 signaling pathway     103245758 (FADD)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103245758 (FADD)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103245758 (FADD)    05161 Hepatitis B     103245758 (FADD)    05160 Hepatitis C     103245758 (FADD)    05164 Influenza A     103245758 (FADD)    05162 Measles     103245758 (FADD)    05168 Herpes simplex virus 1 infection     103245758 (FADD)    05163 Human cytomegalovirus infection     103245758 (FADD)    05167 Kaposi sarcoma-associated herpesvirus infection     103245758 (FADD)    05169 Epstein-Barr virus infection     103245758 (FADD)    05165 Human papillomavirus infection     103245758 (FADD)   09171 Infectious disease: bacterial    05132 Salmonella infection     103245758 (FADD)    05152 Tuberculosis     103245758 (FADD)   09174 Infectious disease: parasitic    05142 Chagas disease     103245758 (FADD)   09164 Neurodegenerative disease    05010 Alzheimer disease     103245758 (FADD)    05022 Pathways of neurodegeneration - multiple diseases     103245758 (FADD)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     103245758 (FADD)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     103245758 (FADD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DED Death tRNA_NucTran2_2 Motif Other DBs NCBI-GeneID:  103245758 NCBI-ProteinID:  XP_008015118 LinkDB All DBs Position 1:complement(4358314..4361863) Genome browser AA seq 208 aa AA seqDB search MDPFLVLLHSVSSSLSSSELTELKFLCLGRVSKRKLERVQSGLDLFSVLLEQNDLEPGHT DLLRELLASLRRHDLLRRLDDFEAGVAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLK VSDAKIDGIEDRYPRNLTERVRESLRIWKNTEKENATVACLVAALRACQMNLVADLVQEV QQARDLQNRSGAMSPMSWNSDASTSEAS NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggacccgttcctggtgctgctgcactcggtgtcgtccagcctgtcgagcagtgagctg accgagctcaagttcctatgcctcgggcgcgtgagcaagcgcaagctggagcgcgtgcag agcggcctggacctcttctccgtgctgctggagcagaacgacctggagcccgggcacacc gacctcctgcgcgagctgctcgcctccctgcggcgccacgacctgctgcggcgcctcgac gacttcgaggcgggggtggctgccggggccgcgcctggggaagaagacctgtgtgcagca tttaacgtcatatgtgataatgtggggaaagactggagaaggctggctcgtcagctcaaa gtctcagacgccaagattgacggcatcgaggacagatacccccgcaacctgacagagcgc gtgcgggagtcactgagaatctggaagaacacagagaaggagaacgcaacggtggcctgc ctggtggcggctctcagggcctgccagatgaacctggtggccgacctggtacaagaggtt cagcaggcccgggacctccagaacaggagtggggccatgtccccaatgtcatggaactca gacgcatccacctccgaagcatcgtga

DBGET integrated database retrieval system