Chlorocebus sabaeus (green monkey): 103248585 Help Entry 103248585         CDS       T04361                                  Symbol CD3D Name (RefSeq) CD3d molecule   KO K06450   T-cell surface glycoprotein CD3 delta chain Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04640   Hematopoietic cell lineage csab04658   Th1 and Th2 cell differentiation csab04659   Th17 cell differentiation csab04660   T cell receptor signaling pathway csab05142   Chagas disease csab05162   Measles csab05166   Human T-cell leukemia virus 1 infection csab05169   Epstein-Barr virus infection csab05170   Human immunodeficiency virus 1 infection csab05235   PD-L1 expression and PD-1 checkpoint pathway in cancer csab05340   Primary immunodeficiency Brite KEGG Orthology (KO) [BR:csab00001]  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     103248585 (CD3D)    04660 T cell receptor signaling pathway     103248585 (CD3D)    04658 Th1 and Th2 cell differentiation     103248585 (CD3D)    04659 Th17 cell differentiation     103248585 (CD3D)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103248585 (CD3D)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103248585 (CD3D)    05170 Human immunodeficiency virus 1 infection     103248585 (CD3D)    05162 Measles     103248585 (CD3D)    05169 Epstein-Barr virus infection     103248585 (CD3D)   09174 Infectious disease: parasitic    05142 Chagas disease     103248585 (CD3D)   09163 Immune disease    05340 Primary immunodeficiency     103248585 (CD3D)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04090 CD molecules [BR:csab04090]     103248585 (CD3D) CD molecules [BR:csab04090]  Proteins   103248585 (CD3D) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ig_4 ITAM Ig_5 DAP10 Motif Other DBs NCBI-GeneID:  103248585 NCBI-ProteinID:  XP_008019240 Ensembl:  ENSCSAG00000002600 UniProt:  A0A0D9S3K4 LinkDB All DBs Position 1:complement(109715148..109719576) Genome browser AA seq 171 aa AA seqDB search MEHSMFLSGLVLATLLSQVSPFEIPVEELEDRVFVKCNTSITWVEGTVGTLLTNNTRLDL GKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQNCVELDPATLAGIIVTDVIATLLLAL GVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSRLGGNWARNK NT seq 516 nt NT seq  +upstreamnt  +downstreamnt atggaacatagcatgtttctgtctggactggtactggctacccttctctcccaagtgagc cccttcgagatacctgtagaggaacttgaggacagagtgtttgtgaaatgcaataccagc atcacatgggtagagggaacggtgggaacactgctcacaaataatacaagactggacctg ggaaaacgcatcctggacccacgaggaatatataggtgtaatgggacagatatatacaag gacaaagaatctactgtgcaagttcattatcgaatgtgccagaactgtgtggagctggat ccagccactctggctggcatcattgtcactgatgtcattgccactctgctccttgctttg ggagtcttctgctttgctggacatgagactggaaggctctctggggctgccgacacacaa gctctattgaggaatgaccaggtctatcagcccctccgagatcgagatgatgctcagtac agccgccttggaggaaactgggctcggaacaagtga

DBGET integrated database retrieval system