Cololabis saira (Pacific saury): 133447604 Help Entry 133447604         CDS       T09849                                  Symbol ran Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism csai  Cololabis saira (Pacific saury) Pathway csai03008   Ribosome biogenesis in eukaryotes csai03013   Nucleocytoplasmic transport csai03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:csai00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     133447604 (ran)    03008 Ribosome biogenesis in eukaryotes     133447604 (ran)   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     133447604 (ran)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:csai03019]     133447604 (ran)    03009 Ribosome biogenesis [BR:csai03009]     133447604 (ran)    03016 Transfer RNA biogenesis [BR:csai03016]     133447604 (ran)    03036 Chromosome and associated proteins [BR:csai03036]     133447604 (ran)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csai04147]     133447604 (ran)    04031 GTP-binding proteins [BR:csai04031]     133447604 (ran) Messenger RNA biogenesis [BR:csai03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      133447604 (ran) Ribosome biogenesis [BR:csai03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     133447604 (ran)   Pre-60S particles     133447604 (ran) Transfer RNA biogenesis [BR:csai03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     133447604 (ran) Chromosome and associated proteins [BR:csai03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      133447604 (ran)    Spindle formation proteins     133447604 (ran) Exosome [BR:csai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    133447604 (ran) GTP-binding proteins [BR:csai04031]  Small (monomeric) G-proteins   Ran Family    Ran     133447604 (ran) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RNA_helicase ArgoMid Pox_A32 AAA_24 TsaE AAA_7 DUF5906 DUF5935 Motif Other DBs NCBI-GeneID:  133447604 NCBI-ProteinID:  XP_061582302 LinkDB All DBs Position 7:complement(29392076..29395257) Genome browser AA seq 219 aa AA seqDB search MADSMGQCVPVAVFKLVLVGDGGTGKTTFVKRHITGEFEKKYVATLGVEVHPLMFHTNRG PIKYNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPI VLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFV AMPALAPPEVQMDPTLAAKYEEELQVASQTALPDEEDDL NT seq 660 nt NT seq  +upstreamnt  +downstreamnt atggctgactcaatgggacagtgtgtgccggtggctgtgttcaagcttgtgttggtagga gatggaggcacaggaaaaactacttttgtgaagaggcatattacaggagagtttgagaag aagtatgtagcaaccctgggagttgaagtgcacccactgatgttccacaccaacagagga cccattaagtataatgtctgggacacagctggtcaagaaaagtttggtggtctgagagat ggctactacattcaagctcagtgtgcgatcatcatgtttgacgtaacctctcgggtcact tacaagaatgtgccaaactggcatcgtgacctggtgcgcgtctgtgagaacattcccatc gttctttgcggcaacaaggtagacatcaaagacaggaaagtcaaagccaagagcatcgtg tttcaccgcaagaagaacctgcagtactatgacatttctgccaaaagtaactacaacttc gagaagcccttcctgtggttagcaaggaagttgattggtgatcccaacttggagtttgtg gctatgcctgcccttgctcccccagaggtccagatggaccccacccttgccgctaaatat gaggaagagcttcaagttgcatcacagacagcactcccagatgaagaagatgacctctaa

DBGET integrated database retrieval system