Cololabis saira (Pacific saury): 133457797 Help Entry 133457797         CDS       T09849                                  Symbol pole4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism csai  Cololabis saira (Pacific saury) Pathway csai03030   DNA replication csai03410   Base excision repair csai03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:csai00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     133457797 (pole4)    03410 Base excision repair     133457797 (pole4)    03420 Nucleotide excision repair     133457797 (pole4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:csai03032]     133457797 (pole4)    03400 DNA repair and recombination proteins [BR:csai03400]     133457797 (pole4) Enzymes [BR:csai01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      133457797 (pole4) DNA replication proteins [BR:csai03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     133457797 (pole4) DNA repair and recombination proteins [BR:csai03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       133457797 (pole4) SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAF TFIID-31kDa Motif Other DBs NCBI-GeneID:  133457797 NCBI-ProteinID:  XP_061593119 LinkDB All DBs Position 13:complement(20523250..20528517) Genome browser AA seq 121 aa AA seqDB search MAATVATPATPAELVPERCGSEEEARGEPEDGAPPPAAPGRPSRLPLARIKALMKTDPDV SLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIEAIDEFAFLEGTL D NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggcagcgacggtggcgacgcctgccactcccgcggagctagtgccggagcggtgcggg agcgaggaggaggcccgcggggagccggaggacggcgctccgccgccggcggcccccggc cggccgtccaggctgccgctggcccgcatcaaagccctgatgaaaaccgacccggacgtg tcgctggccagccaggagtccgtgttcatcatcgctaaagccacggagttgtttgttgag atgattgccaaagatgctctggtgtacgctcagcaaggcaagaggaaaacattacaaaga aaagacttagacaatgcaatagaggccatcgatgaatttgcctttctcgaaggcacacta gactaa

DBGET integrated database retrieval system