Camelina sativa (false flax): 104706402 Help Entry 104706402         CDS       T05044                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism csat  Camelina sativa (false flax) Pathway csat03420   Nucleotide excision repair csat04120   Ubiquitin mediated proteolysis csat04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:csat00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104706402    04120 Ubiquitin mediated proteolysis     104706402   09124 Replication and repair    03420 Nucleotide excision repair     104706402  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:csat04121]     104706402    03400 DNA repair and recombination proteins [BR:csat03400]     104706402 Enzymes [BR:csat01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      104706402 Ubiquitin system [BR:csat04121]  Ubiquitin ligases (E3)   UBL E3 ligases    104706402   Multi subunit type E3    SCF complex     Ring finger protein      104706402    Cul2 complex      104706402    Cul3 complex      104706402    Cul4 complex      104706402    Cul7 complex      104706402    Cul8 complex      104706402    Cul9 complex      104706402 DNA repair and recombination proteins [BR:csat03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       104706402     TCR (transcription coupled repair) factors      Cul4-CSA complex       104706402 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  104706402 NCBI-ProteinID:  XP_010420893 LinkDB All DBs Position 8:complement(6014900..6016529) Genome browser AA seq 117 aa AA seqDB search MATLDSDVPMIPAGGASGSAASSSTKKPKRFEIKKWSAVSLWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggcgactctagactccgacgttcctatgattcctgcgggaggagcctctggcagcgct gcttcgtcttccacaaagaaacctaagcgattcgaaatcaaaaagtggagcgccgtttct ctctgggcttgggatatcgttgttgacaactgtgcgatctgcagaaaccacatcatggat ctctgcatcgagtgtcaagctaatcaggccagcgctactagtgaggaatgcaccgttgct tggggggtttgcaatcatgccttccactttcactgcatcagcagatggctaaagactcgt caagtttgtccgttagataacagtgagtgggagttccagaaatatggtcactaa

DBGET integrated database retrieval system