Camelina sativa (false flax): 104721894 Help Entry 104721894         CDS       T05044                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism csat  Camelina sativa (false flax) Pathway csat00510   N-Glycan biosynthesis csat00513   Various types of N-glycan biosynthesis csat04141   Protein processing in endoplasmic reticulum Module csat_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:csat00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     104721894    00513 Various types of N-glycan biosynthesis     104721894  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104721894 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 PRA1 LapA_dom Motif Other DBs NCBI-GeneID:  104721894 NCBI-ProteinID:  XP_010438273 LinkDB All DBs Position 11:6064386..6066005 Genome browser AA seq 76 aa AA seqDB search MAAKPIASPISVALYPTLSVFTLAIGLVITAIFFIYETTSSRKNRSLGKELATSAVASVF LGFGSLFLLLASGVYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcggcgaaaccgattgcgagtccgatttcggtggcgctgtatccgactttgtcggtg ttcactttggcgattggcctcgtcattactgctatcttcttcatctacgaaactacctca tccaggaaaaaccgaagcctcggaaaggagctcgctacttctgcagttgcatctgtcttc ttgggatttggatcgttgtttttgctacttgctagtggcgtttatgtctaa

DBGET integrated database retrieval system