Camelina sativa (false flax): 104736126 Help Entry 104736126         CDS       T05044                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism csat  Camelina sativa (false flax) Pathway csat03420   Nucleotide excision repair csat04120   Ubiquitin mediated proteolysis csat04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:csat00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104736126    04120 Ubiquitin mediated proteolysis     104736126   09124 Replication and repair    03420 Nucleotide excision repair     104736126  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:csat04121]     104736126    03400 DNA repair and recombination proteins [BR:csat03400]     104736126 Enzymes [BR:csat01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      104736126 Ubiquitin system [BR:csat04121]  Ubiquitin ligases (E3)   UBL E3 ligases    104736126   Multi subunit type E3    SCF complex     Ring finger protein      104736126    Cul2 complex      104736126    Cul3 complex      104736126    Cul4 complex      104736126    Cul7 complex      104736126    Cul8 complex      104736126    Cul9 complex      104736126 DNA repair and recombination proteins [BR:csat03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       104736126     TCR (transcription coupled repair) factors      Cul4-CSA complex       104736126 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  104736126 NCBI-ProteinID:  XP_010454359 LinkDB All DBs Position 13:complement(9124876..9126477) Genome browser AA seq 116 aa AA seqDB search MATLDSDVPMIPAGGASGSASSSTKKPKRFEIKKWSAVSLWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcaactcttgactccgacgttcctatgattcctgccggaggagcctctggtagcgct tcgtcttccacaaagaaacctaagcgattcgaaatcaaaaagtggagcgccgtttctctc tgggcttgggatatcgttgttgacaactgtgcgatctgcagaaaccacatcatggatctc tgcatcgagtgtcaagctaatcaggccagtgctactagtgaggaatgcaccgttgcttgg ggggtttgcaatcatgccttccactttcactgcatcagcaggtggctaaagactcgtcaa gtttgtccattagataacagtgagtgggagttccagaaatatggtcactaa

DBGET integrated database retrieval system