Camelina sativa (false flax): 104790623 Help Entry 104790623         CDS       T05044                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism csat  Camelina sativa (false flax) Pathway csat03420   Nucleotide excision repair csat04120   Ubiquitin mediated proteolysis csat04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:csat00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104790623    04120 Ubiquitin mediated proteolysis     104790623   09124 Replication and repair    03420 Nucleotide excision repair     104790623  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:csat04121]     104790623    03400 DNA repair and recombination proteins [BR:csat03400]     104790623 Enzymes [BR:csat01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      104790623 Ubiquitin system [BR:csat04121]  Ubiquitin ligases (E3)   UBL E3 ligases    104790623   Multi subunit type E3    SCF complex     Ring finger protein      104790623    Cul2 complex      104790623    Cul3 complex      104790623    Cul4 complex      104790623    Cul7 complex      104790623    Cul8 complex      104790623    Cul9 complex      104790623 DNA repair and recombination proteins [BR:csat03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       104790623     TCR (transcription coupled repair) factors      Cul4-CSA complex       104790623 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  104790623 NCBI-ProteinID:  XP_010514706 UniProt:  A0ABM0ZEP6 LinkDB All DBs Position 6:complement(7767291..7770150) Genome browser AA seq 115 aa AA seqDB search MASIDSDVPMIPAGEASSSTVPSKKSKRFEIKKWSAVSLWAWDIVVDNCAICRNHIMDLC IECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggcttccatcgactccgacgttcctatgatccccgctggcgaagcctccagcagcacc gttccttcaaagaaatcaaaacgctttgaaattaagaagtggagcgccgtctctctttgg gcttgggatatcgttgttgataactgcgctatctgtaggaatcacatcatggatctctgt attgaatgtcaagctaatcaggctagtgctaccagcgaagaatgtactgttgcttggggg gtttgcaaccatgcctttcacttccactgtatcagcagatggctgaagacccgtcaagtg tgtccactggataatagcgagtgggaattccaaaaatatggtcattaa

DBGET integrated database retrieval system