Cannabis sativa (hemp): 115707585 Help Entry 115707585         CDS       T08987                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism csav  Cannabis sativa (hemp) Pathway csav03420   Nucleotide excision repair csav04120   Ubiquitin mediated proteolysis csav04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:csav00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     115707585    04120 Ubiquitin mediated proteolysis     115707585   09124 Replication and repair    03420 Nucleotide excision repair     115707585  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:csav04121]     115707585    03400 DNA repair and recombination proteins [BR:csav03400]     115707585 Enzymes [BR:csav01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      115707585 Ubiquitin system [BR:csav04121]  Ubiquitin ligases (E3)   UBL E3 ligases    115707585   Multi subunit type E3    SCF complex     Ring finger protein      115707585    Cul2 complex      115707585    Cul3 complex      115707585    Cul4 complex      115707585    Cul7 complex      115707585    Cul8 complex      115707585    Cul9 complex      115707585 DNA repair and recombination proteins [BR:csav03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       115707585     TCR (transcription coupled repair) factors      Cul4-CSA complex       115707585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  115707585 NCBI-ProteinID:  XP_030491458 UniProt:  A0AB40ECN3 LinkDB All DBs Position 1:complement(20416241..20418307) Genome browser AA seq 116 aa AA seqDB search MATLDTDVPMVPAGEPSSSAGPSSRKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggctactctagatactgacgttcccatggttcccgccggcgaaccttcgagcagtgct ggtccttccagcaggaaacccaagcgattcgagatcaaaaaatggaacgccgttgctcta tgggcttgggatatcgttgtcgataactgtgcgatctgcaggaaccatatcatggatctt tgtatcgagtgccaagccaaccaggctagcgccaccagcgaggagtgtacggttgcttgg ggggtttgcaaccatgcttttcactttcactgcattagccgttggctcaagacccgtcaa gtttgtccactggataacagtgaatgggagtttcagaagtatggtcactag

DBGET integrated database retrieval system