Cryptotermes secundus (drywood termite): 111865959 Help Entry 111865959         CDS       T07421                                  Name (RefSeq) dihydrofolate reductase-like   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism csec  Cryptotermes secundus (drywood termite) Pathway csec00670   One carbon pool by folate csec00790   Folate biosynthesis csec01100   Metabolic pathways csec01240   Biosynthesis of cofactors csec04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:csec00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     111865959    00670 One carbon pool by folate     111865959  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     111865959 Enzymes [BR:csec01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      111865959 SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-GeneID:  111865959 NCBI-ProteinID:  XP_023710170 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MVHNGYEGYEKPVMETSRLKMSFKLNLIVAVSENMGIGINGDLPWRLRKEMAHFSRMTKC TKDSTKQNAVIMGRKTWESIPEKKRPLEGRINLVLSRQNLYV NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggttcacaatggttatgagggttatgagaaaccagtcatggaaacatcaaggttgaaa atgagttttaaactgaatctgattgtagcagttagtgaaaatatgggtatcggtataaat ggggatttgccctggagattaagaaaagagatggcacacttttcacgaatgaccaagtgc acaaaggattccaccaaacagaatgcagtgataatggggagaaagacatgggagtcaatt ccagaaaagaagcgaccccttgaaggacggatcaaccttgtactgtcacgacaaaatctg tatgtatag

DBGET integrated database retrieval system