Cryptotermes secundus (drywood termite): 111871976 Help Entry 111871976         CDS       T07421                                  Name (RefSeq) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism csec  Cryptotermes secundus (drywood termite) Pathway csec00670   One carbon pool by folate csec00790   Folate biosynthesis csec01100   Metabolic pathways csec01240   Biosynthesis of cofactors csec04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:csec00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     111871976    00670 One carbon pool by folate     111871976  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     111871976 Enzymes [BR:csec01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      111871976 SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-GeneID:  111871976 NCBI-ProteinID:  XP_023721189 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MHDLLDRYEIPVMETSRLKLRFKLNLIVADSENMGIGINGDLPWRLRILGPNVLVCSSLE TALQRLQEPPLAESVESAWIIGGSSVYKEAMALPQCSRIYLTEIFKTFKGDM NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgcacgaccttctcgaccgttatgagataccagttatggaaacatcaaggttgaaactg agatttaaactgaatcttattgtagcagatagtgaaaatatgggtatcggtataaatggg gatttgccctggagattaaggattctggggccaaatgtgctggtgtgtagctcattggaa actgctcttcagagactgcaggagcccccacttgcagaaagtgtcgagtcagcatggatt atagggggaagttcagtatacaaggaagcaatggctttacctcagtgctcccgtatttac ctgacagaaatcttcaagactttcaaaggtgatatg

DBGET integrated database retrieval system