Cynoglossus semilaevis (tongue sole): 103387352 Help Entry 103387352         CDS       T04866                                  Symbol cxcl12 Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism csem  Cynoglossus semilaevis (tongue sole) Pathway csem04060   Cytokine-cytokine receptor interaction csem04672   Intestinal immune network for IgA production csem04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:csem00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103387352 (cxcl12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103387352 (cxcl12)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     103387352 (cxcl12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csem04052]     103387352 (cxcl12)    00536 Glycosaminoglycan binding proteins [BR:csem00536]     103387352 (cxcl12) Cytokines and neuropeptides [BR:csem04052]  Cytokines   Chemokines    103387352 (cxcl12) Glycosaminoglycan binding proteins [BR:csem00536]  Heparan sulfate / Heparin   Chemokines    103387352 (cxcl12) SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  103387352 NCBI-ProteinID:  XP_008320172 UniProt:  A0A3P8VFU6 LinkDB All DBs Position 12 Genome browser AA seq 98 aa AA seqDB search MDVKLLALVAALTVLTYAPPSQAKPISLVERCYCRSRVNSLPRSIIRELRFIHTPNCPFQ VIAKLKNNKEVCVNPEIRWLQQYLKNAINKMKKTKQAL NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggatgtgaaactgttggcactggtggctgcgctcaccgttctcacatatgcgcctcca tcacaagcaaagcccatcagcctggtggagagatgctactgccgctccagagtcaacagc ctcccacggagcattatccgagagctccggttcatccacacgcctaactgtccctttcaa gtcattgccaaactgaagaacaacaaagaggtgtgtgtaaacccagagatccggtggctg cagcagtacctgaaaaacgctatcaacaaaatgaagaaaaccaagcaggccctgtaa

DBGET integrated database retrieval system