Cronobacter malonaticus CMCC45402: P262_01171 Help Entry P262_01171        CDS       T02955                                  Name (GenBank) hypothetical protein   KO K01737   6-pyruvoyltetrahydropterin/6-carboxytetrahydropterin synthase [EC:4.2.3.12 4.1.2.50] Organism csi  Cronobacter malonaticus CMCC45402 Pathway csi00790   Folate biosynthesis csi01100   Metabolic pathways csi01240   Biosynthesis of cofactors Module csi_M00988   PreQ1 biosynthesis, GTP => 7-Aminomethyl-7-deazaguanine Brite KEGG Orthology (KO) [BR:csi00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     P262_01171  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:csi03016]     P262_01171 Enzymes [BR:csi01000]  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.50  6-carboxytetrahydropterin synthase      P262_01171   4.2  Carbon-oxygen lyases    4.2.3  Acting on phosphates     4.2.3.12  6-pyruvoyltetrahydropterin synthase      P262_01171 Transfer RNA biogenesis [BR:csi03016]  Prokaryotic type   tRNA modification factors    Other tRNA modification factors     P262_01171 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PTPS Motif Other DBs NCBI-ProteinID:  AHB69194 UniProt:  V5TXC1 LinkDB All DBs Position complement(869698..869958) Genome browser AA seq 86 aa AA seqDB search MVRLEVTGEVDPHTGWIIDFAELKAAFKPIYDSLDHYYLNDIPGLENPTSEVLARWIWDQ MKPRLPLLSAVMIKETCTAGCVYRGE NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggtgcgcctggaggtaacgggcgaggtagaccctcataccggctggattatcgatttc gccgagctgaaagcggcgtttaagccgatctacgatagcctggatcactattatctgaac gatattccgggccttgaaaacccgaccagcgaagtgctggcgcgctggatttgggatcag atgaaaccccgcctgccgctgctgagcgcggtgatgattaaagagacctgcaccgcgggt tgcgtatatcgcggcgaataa

DBGET integrated database retrieval system