Camellia sinensis (tea plant): 114285091 Help Entry 114285091         CDS       T07364                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism csin  Camellia sinensis (tea plant) Pathway csin00510   N-Glycan biosynthesis csin00513   Various types of N-glycan biosynthesis csin04141   Protein processing in endoplasmic reticulum Module csin_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:csin00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     114285091    00513 Various types of N-glycan biosynthesis     114285091  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     114285091 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  114285091 NCBI-ProteinID:  XP_028083886 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MGLLHSGSEVEAKDLSIHHHHHKKMAQSVKPISSPVPDAWYPTLAVFMLAIGLVVTASFF IYEATSSRKNRCLAKELTTGAVASVFLGFGSLFLLIASGVYV NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgggtcttcttcattccggcagtgaagtcgaagcgaaagatctatcgatccatcatcat catcacaaaaaaatggctcagtcagtgaaacctatctcgagccccgtcccagacgcctgg tacccaaccctagctgttttcatgctcgcaattgggcttgttgtcaccgcttccttcttc atctatgaagcaacctcttcgaggaaaaatcgctgcctggcaaaggagctgacaacagga gcagttgcatctgtctttctgggtttcggatccttgttcttactcattgctagcggtgtt tatgtttga

DBGET integrated database retrieval system