Camellia sinensis (tea plant): 114302496 Help Entry 114302496         CDS       T07364                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism csin  Camellia sinensis (tea plant) Pathway csin03420   Nucleotide excision repair csin04120   Ubiquitin mediated proteolysis csin04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:csin00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     114302496    04120 Ubiquitin mediated proteolysis     114302496   09124 Replication and repair    03420 Nucleotide excision repair     114302496  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:csin04121]     114302496    03400 DNA repair and recombination proteins [BR:csin03400]     114302496 Enzymes [BR:csin01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      114302496 Ubiquitin system [BR:csin04121]  Ubiquitin ligases (E3)   UBL E3 ligases    114302496   Multi subunit type E3    SCF complex     Ring finger protein      114302496    Cul2 complex      114302496    Cul3 complex      114302496    Cul4 complex      114302496    Cul7 complex      114302496    Cul8 complex      114302496    Cul9 complex      114302496 DNA repair and recombination proteins [BR:csin03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       114302496     TCR (transcription coupled repair) factors      Cul4-CSA complex       114302496 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  114302496 NCBI-ProteinID:  XP_028103326 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MASLDTDVTMVPVGGDGSGAAGPSSSTASTSSSSKKAKRFEIKKWNAVALWAWDIVVDNC AICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWE FQKYGH NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atggcttctctagacaccgatgtcaccatggttccggtcggcggcgacggctcaggcgcc gccggaccatcgtcctccaccgcctcaacatcgtcttcctccaagaaggccaagcgattc gaaatcaagaagtggaacgccgtcgctctttgggcttgggatattgttgtggataactgt gcgatttgcaggaaccatatcatggatctctgtattgagtgccaagccaaccaagctagt gccacaagcgaagaatgtactgtcgcttggggggtttgcaaccatgcattccacttccac tgcatcagccgctggctcaagacacgtcaagtgtgtccattggataacagcgagtgggag tttcagaagtatggccactag

DBGET integrated database retrieval system