Ceratosolen solmsi marchali (fig wasp): 105360210 Help Entry 105360210         CDS       T06056                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism csol  Ceratosolen solmsi marchali (fig wasp) Pathway csol00510   N-Glycan biosynthesis csol00513   Various types of N-glycan biosynthesis csol04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:csol00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     105360210    00513 Various types of N-glycan biosynthesis     105360210  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105360210 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 Cation_efflux TctB CAAD Pestivirus_E2 Motif Other DBs NCBI-GeneID:  105360210 NCBI-ProteinID:  XP_011495352 UniProt:  A0AAJ6VNQ5 LinkDB All DBs Position Unknown AA seq 81 aa AA seqDB search MTLEIENMTRYISPINPTVFPLLALILLGIGIFFTAWFFVYEVTSTKFTRDIFKELLISL VAALFSGFGVLFLLLWVGIYV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacgttggaaattgagaatatgacaagatatatttcaccaatcaacccaacagtattt ccacttctagcacttattttattgggcattggaatcttcttcacagcttggttttttgtc tacgaagttaccagtacaaagtttactcgagatatatttaaagaattattgatttctcta gtggcggcattattttcaggatttggggtcttatttctgttactgtgggttggtatttac gtttag

DBGET integrated database retrieval system