Corynebacterium simulans: WM42_1758 Help Entry WM42_1758         CDS       T04316                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism csp  Corynebacterium simulans Pathway csp00790   Folate biosynthesis csp01100   Metabolic pathways csp01240   Biosynthesis of cofactors Module csp_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:csp00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     WM42_1758 (folB) Enzymes [BR:csp01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      WM42_1758 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      WM42_1758 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      WM42_1758 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AMO89477 LinkDB All DBs Position 1829674..1830048 Genome browser AA seq 124 aa AA seqDB search MADRIELTGLECFGYHGVFEEEKREGQPFLVDITCWTEFPTTDDLANTVSYAELADVAAD IVEGPSRDLIETVANEVADTVMQRYDLLHAVEVTIHKPKAPIPRTFADVAVVARRSRKSM RGGK NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atggcagaccgcatcgaactgaccggcctggagtgctttggctaccacggtgtcttcgaa gaagaaaagcgcgagggtcagcccttcctggtggacatcacctgctggactgagttccca accacagatgaccttgcgaacaccgtaagctacgccgagcttgccgacgtcgcggcggac atcgtcgagggcccgtcgcgcgatctcatcgagaccgtggccaacgaggtggccgatacc gtgatgcagcgttatgacctgctgcatgcggtcgaggtgaccattcataagccgaaggcg ccgattccgcgcaccttcgccgacgtcgccgtcgtggcgcgtcgctcgcgaaagagcatg cgaggaggcaagtga

DBGET integrated database retrieval system