Colius striatus (speckled mousebird): 104552073 Help Entry 104552073         CDS       T08355                                  Symbol IL6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism csti  Colius striatus (speckled mousebird) Pathway csti04060   Cytokine-cytokine receptor interaction csti04068   FoxO signaling pathway csti04218   Cellular senescence csti04620   Toll-like receptor signaling pathway csti04621   NOD-like receptor signaling pathway csti04623   Cytosolic DNA-sensing pathway csti04625   C-type lectin receptor signaling pathway csti04672   Intestinal immune network for IgA production csti05132   Salmonella infection csti05164   Influenza A csti05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:csti00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     104552073 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104552073 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     104552073 (IL6)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104552073 (IL6)    04621 NOD-like receptor signaling pathway     104552073 (IL6)    04623 Cytosolic DNA-sensing pathway     104552073 (IL6)    04625 C-type lectin receptor signaling pathway     104552073 (IL6)    04672 Intestinal immune network for IgA production     104552073 (IL6)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104552073 (IL6)    05168 Herpes simplex virus 1 infection     104552073 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     104552073 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csti04052]     104552073 (IL6) Cytokines and neuropeptides [BR:csti04052]  Cytokines   Interleukins    104552073 (IL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 IL23 GCSF TetR_C_27 MMR_HSR1_Xtn DUF7811 Motif Other DBs NCBI-GeneID:  104552073 NCBI-ProteinID:  XP_010206042 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search ATEPLRVSPQLCNKFTVCENSMEMLMQNDLNLPQVTEEDGCLLDGFNEDKCLRKISSGLY TFRTYLEYVKETFTSEKQHVDSLCNSTERLAHIIRQMVINPDEVIIPDSATQESLHKKLK SNKKWIEKITIHLILRDFTSFMEKTMRAVRYLKHTRSFSV NT seq 485 nt NT seq  +upstreamnt  +downstreamnt gtgcaacggaacctcttcgtgtctctccccagctatgcaacaagttcactgtatgcgaga acagcatggaaatgctcatgcagaacgacctcaacctcccccaagtgacagaagaagacg ggtgtctgctcgacggcttcaatgaggataaatgcttaaggaaaatctccagtgggcttt atacatttcggacataccttgaatacgtaaaagaaacttttactagtgaaaagcaacacg ttgattccctgtgcaatagcacagagcgtctggcacatatcataagacagatggtgatca accccgatgaagtgatcatcccagactcggctacccaggaatccctccacaaaaagctga agtccaacaagaaatggatagagaaaatcaccatccacctcatcctccgagactttactt catttatggagaaaactatgagggctgttcgctatttgaaacacaccaggagtttcagtg tctga

DBGET integrated database retrieval system