Colius striatus (speckled mousebird): 104553073 Help Entry 104553073         CDS       T08355                                  Name (RefSeq) dihydrofolate reductase-like   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism csti  Colius striatus (speckled mousebird) Pathway csti00670   One carbon pool by folate csti00790   Folate biosynthesis csti01100   Metabolic pathways csti01240   Biosynthesis of cofactors csti04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:csti00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     104553073    00670 One carbon pool by folate     104553073  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     104553073 Enzymes [BR:csti01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      104553073 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-GeneID:  104553073 NCBI-ProteinID:  XP_010193886 LinkDB All DBs Position Unknown AA seq 145 aa AA seqDB search MLDGGNNPAVLEGDCGRAPQPCQGAPSDLGKRVGRLSDVGYHSCKQRWGQRNEYKYFQRM TSTSHVEGKQNALIMGRKTWFSIPEKNRPLKDRINIVLSTELKETPKGAHYLSKSLDDAL ALLDSSELKSKVDMVWIVGGTSVYK NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atgctcgacggcgggaacaatcccgcagtgctggagggcgattgcggccgggccccgcag ccttgccagggagccccgagcgacttggggaagcgcgtcggcaggctttcagacgtgggg tatcattcgtgcaagcagcgctggggccaaaggaatgagtacaagtactttcagagaatg accagcacatcccatgtggaaggtaaacagaatgcactgataatgggtagaaaaacgtgg ttctccattcctgagaagaatcgtcctttaaaagacagaattaatatagtgctcagcacg gagctcaaggaaaccccaaaaggagcacattacctttccaaaagtctggatgatgcttta gctcttttggattcatcagagttaaaaagtaaagtagacatggtttggatcgtcggaggc acttcagtttacaag

DBGET integrated database retrieval system