Chlamydia suis: Chls_965 Help Entry Chls_965          CDS       T07130                                  Symbol folA Name (GenBank) Dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism csui  Chlamydia suis Pathway csui00670   One carbon pool by folate csui00790   Folate biosynthesis csui01100   Metabolic pathways csui01240   Biosynthesis of cofactors csui04981   Folate transport and metabolism Module csui_M00840   Tetrahydrofolate biosynthesis, mediated by ribA and trpF, GTP => THF Brite KEGG Orthology (KO) [BR:csui00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Chls_965 (folA)    00670 One carbon pool by folate     Chls_965 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     Chls_965 (folA) Enzymes [BR:csui01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      Chls_965 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  QHP83840 LinkDB All DBs Position complement(1066306..1066776) Genome browser AA seq 156 aa AA seqDB search MIQATGIVAIDPRGVMGASGKLPWSYPEDLRFFAETIQHHPIIMGRKTWESLPDKYKCGR TVVVFSQKHRLSQGVWISSLAEYEKLSLDSPFLIGGAELFEYFFQQNLLKACFVTHIQKT YPGDTYFPVKHLLGWKRKRIRQTENFAIYYYENYAD NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgattcaagcaacaggcattgttgctattgatcctcgaggagtgatgggagcttcagga aagctcccctggagttatccagaggatctacgcttctttgcagaaacgattcaacaccac ccgattattatgggaagaaagacttgggagtctcttcccgataagtataagtgtggtcgc actgtggttgttttttctcaaaaacacagattatctcaaggggtgtggatttcttcctta gcagagtatgaaaagctgtcactagactctcctttcttaatagggggggcggagctcttt gagtatttttttcagcagaaccttctgaaagcttgttttgtgacgcatatacaaaaaacg tatccgggagatacatatttccctgtaaagcacttgttgggctggaaaaggaagcgtatt cgccaaacagaaaattttgctatttattattatgaaaattacgccgattaa

DBGET integrated database retrieval system