Corynebacterium suranareeae: N24_2873 Help Entry N24_2873          CDS       T07007                                  Name (GenBank) hypothetical protein   KO K01739   cystathionine gamma-synthase [EC:2.5.1.48] Organism csur  Corynebacterium suranareeae Pathway csur00270   Cysteine and methionine metabolism csur00450   Selenocompound metabolism csur00920   Sulfur metabolism csur01100   Metabolic pathways csur01110   Biosynthesis of secondary metabolites csur01120   Microbial metabolism in diverse environments csur01230   Biosynthesis of amino acids Module csur_M00017   Methionine biosynthesis, aspartate => homoserine => methionine Brite KEGG Orthology (KO) [BR:csur00001]  09100 Metabolism   09102 Energy metabolism    00920 Sulfur metabolism     N24_2873   09105 Amino acid metabolism    00270 Cysteine and methionine metabolism     N24_2873   09106 Metabolism of other amino acids    00450 Selenocompound metabolism     N24_2873 Enzymes [BR:csur01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.48  cystathionine gamma-synthase      N24_2873 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cys_Met_Meta_PP Motif Other DBs NCBI-ProteinID:  BAU97135 UniProt:  A0A169S4M4 LinkDB All DBs Position complement(3169625..3170017) Genome browser AA seq 130 aa AA seqDB search MRLDRAESNAAELARRLNAHPSVTRVDYPGLLDDPQHEKAVRVLPSGCGNMLSFELDATP ERTDEILEGLSLLTHATSLGGVETAIERRTRWDAEVAAGVPMTLCRVSVGIEDVEDLWED LNASIDKVLG NT seq 393 nt NT seq  +upstreamnt  +downstreamnt gtgcgtcttgatcgagcagaatccaacgcagcggagcttgcgcgtcgactaaatgcgcat ccttcggttacccgcgttgattatccagggcttttagatgatccccaacatgaaaaagct gtgcgagttctaccctctggatgcggaaacatgttgtcatttgagcttgatgcaacacct gaacgaactgatgagattctcgaaggcctgtcactgttaacccacgcgaccagtttgggt ggtgtggaaacagcaattgaacgacgcaccaggtgggatgctgaagtggcggcaggagta cctatgaccctttgccgcgtttcggtaggaattgaagacgttgaagatctgtgggaagac ctcaacgcctcaatcgacaaagtcctgggttag

DBGET integrated database retrieval system