Cucumis sativus (cucumber): 101209687 Help Entry 101209687         CDS       T02486                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism csv  Cucumis sativus (cucumber) Pathway csv03420   Nucleotide excision repair csv04120   Ubiquitin mediated proteolysis csv04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:csv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101209687    04120 Ubiquitin mediated proteolysis     101209687   09124 Replication and repair    03420 Nucleotide excision repair     101209687  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:csv04121]     101209687    03400 DNA repair and recombination proteins [BR:csv03400]     101209687 Enzymes [BR:csv01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      101209687 Ubiquitin system [BR:csv04121]  Ubiquitin ligases (E3)   UBL E3 ligases    101209687   Multi subunit type E3    SCF complex     Ring finger protein      101209687    Cul2 complex      101209687    Cul3 complex      101209687    Cul4 complex      101209687    Cul7 complex      101209687    Cul8 complex      101209687    Cul9 complex      101209687 DNA repair and recombination proteins [BR:csv03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       101209687     TCR (transcription coupled repair) factors      Cul4-CSA complex       101209687 SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  101209687 NCBI-ProteinID:  XP_004141073 UniProt:  A0A0A0LFP5 LinkDB All DBs Position 2 Genome browser AA seq 117 aa AA seqDB search MATLDSDVPMVPAVEASSSAGPSSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggccaccttggactccgacgttccaatggttccagccgtcgaggcttcgagcagtgcc ggtccttcatcttccaagaaacccaagcgttttgagatcaaaaaatggaacgccgtcgct ctttgggcatgggatatcgttgtcgataactgtgcgatctgtaggaaccatatcatggat ctttgtattgagtgtcaagctaaccaggccagcgcaaccagcgaggaatgtaccgtagct tggggggtgtgtaatcatgcatttcatttccactgtatcagtagatggttgaagacacgt caagtttgcccattggataatagcgaatgggaatttcagaagtatggtcactag

DBGET integrated database retrieval system