Cucumis sativus (cucumber): 101211393 Help Entry 101211393         CDS       T02486                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism csv  Cucumis sativus (cucumber) Pathway csv00510   N-Glycan biosynthesis csv00513   Various types of N-glycan biosynthesis csv04141   Protein processing in endoplasmic reticulum Module csv_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:csv00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     101211393    00513 Various types of N-glycan biosynthesis     101211393  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101211393 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF4536 Motif Other DBs NCBI-GeneID:  101211393 NCBI-ProteinID:  XP_004135715 UniProt:  A0A0A0LZE8 LinkDB All DBs Position 1:25705680..25707473 Genome browser AA seq 76 aa AA seqDB search MAPKPVTSPVPEAWYPTLAVLMISVGLIVTASFFIYEATSSRKNRSLAKELTRGTIASIF LGFGSLFLLLASGVYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctccgaaacctgttaccagtcccgttcctgaagcttggtacccaacccttgccgtc ttgatgatctctgttggcctcatcgttaccgcttcgtttttcatctatgaagctacatct tccaggaaaaaccgtagtctggccaaggaactcactcgaggaacaattgcctccattttc ttgggttttggatccttgttcttgttgcttgcttctggtgtttatgtctaa

DBGET integrated database retrieval system