Carlito syrichta (Philippine tarsier): 103253896 Help Entry 103253896         CDS       T07836                                  Symbol POLE4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr03030   DNA replication csyr03410   Base excision repair csyr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:csyr00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     103253896 (POLE4)    03410 Base excision repair     103253896 (POLE4)    03420 Nucleotide excision repair     103253896 (POLE4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:csyr03032]     103253896 (POLE4)    03400 DNA repair and recombination proteins [BR:csyr03400]     103253896 (POLE4) Enzymes [BR:csyr01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      103253896 (POLE4) DNA replication proteins [BR:csyr03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     103253896 (POLE4) DNA repair and recombination proteins [BR:csyr03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       103253896 (POLE4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone TAF CENP-T_C Motif Other DBs NCBI-GeneID:  103253896 NCBI-ProteinID:  XP_008050291 Ensembl:  ENSTSYG00000014553 UniProt:  A0A1U7T8X6 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MAAAAAAGSGTPREEEGPAGEAAAPQPQAPTSAPGARLSRLPLARVKALVKADPDVTLAG QEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcggcggcggcaggaagcgggacgcctcgggaggaggagggacctgctggg gaggcagcggccccacagccccaagccccgacgagcgcacccggagctcgtctctcgagg ctgcctctggcgcgagtgaaggccttggtgaaggcagaccccgacgtgacgctcgcggga caggaagccatcttcattctggcacgagccgcggagctgtttgtggagaccattgcaaaa gatgcctactgctgtgctcaacaaggaaagaggaaaactctccagagaagagatttggat aatgcaatagaagctgtggatgaatttgcttttctggaaggtacattggattga

DBGET integrated database retrieval system