Carlito syrichta (Philippine tarsier): 103259257 Help Entry 103259257         CDS       T07836                                  Symbol IL4 Name (RefSeq) interleukin-4 isoform X1   KO K05430   interleukin 4 Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04060   Cytokine-cytokine receptor interaction csyr04151   PI3K-Akt signaling pathway csyr04630   JAK-STAT signaling pathway csyr04640   Hematopoietic cell lineage csyr04657   IL-17 signaling pathway csyr04658   Th1 and Th2 cell differentiation csyr04659   Th17 cell differentiation csyr04660   T cell receptor signaling pathway csyr04664   Fc epsilon RI signaling pathway csyr04672   Intestinal immune network for IgA production csyr05140   Leishmaniasis csyr05200   Pathways in cancer csyr05310   Asthma csyr05320   Autoimmune thyroid disease csyr05321   Inflammatory bowel disease csyr05330   Allograft rejection Brite KEGG Orthology (KO) [BR:csyr00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     103259257 (IL4)    04151 PI3K-Akt signaling pathway     103259257 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103259257 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     103259257 (IL4)    04660 T cell receptor signaling pathway     103259257 (IL4)    04658 Th1 and Th2 cell differentiation     103259257 (IL4)    04659 Th17 cell differentiation     103259257 (IL4)    04657 IL-17 signaling pathway     103259257 (IL4)    04664 Fc epsilon RI signaling pathway     103259257 (IL4)    04672 Intestinal immune network for IgA production     103259257 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103259257 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     103259257 (IL4)   09163 Immune disease    05310 Asthma     103259257 (IL4)    05320 Autoimmune thyroid disease     103259257 (IL4)    05321 Inflammatory bowel disease     103259257 (IL4)    05330 Allograft rejection     103259257 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csyr04052]     103259257 (IL4)    00536 Glycosaminoglycan binding proteins [BR:csyr00536]     103259257 (IL4) Cytokines and neuropeptides [BR:csyr04052]  Cytokines   Interleukins    103259257 (IL4) Glycosaminoglycan binding proteins [BR:csyr00536]  Heparan sulfate / Heparin   Cytokines    103259257 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 Motif Other DBs NCBI-GeneID:  103259257 NCBI-ProteinID:  XP_008055120 UniProt:  A0A1U7TBB6 LinkDB All DBs Position Unknown AA seq 147 aa AA seqDB search MGLTSQLLPPLFCLLACASNFVHGGKCDITLNEIIKTLNILTERKTPCTELPVADVFAVS KSTTEKETFCRAATVLRQFYSHPEKRSLCRGAHGHHKPLTKFLKGLDRNLYSMANLSYCP VNEARKSTLEDFLKRLKMIMKEKYSKC NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccaactgcttccccctctgttctgcctcctagcatgtgccagcaac ttcgtccatggaggcaaatgcgatatcaccttaaacgagatcatcaaaactttgaacatc ctcacagagagaaagactccatgcaccgagttgcctgtagcagatgtctttgctgtctcc aagagtacaacagagaaagagaccttctgcagggctgcgactgtgcttcggcagttctac agtcaccccgagaagagatccctctgcaggggagcccacggtcaccacaagcctttgacc aaattcctgaaaggactcgacaggaacctctatagcatggcaaacttgagttactgtcct gtgaatgaagccaggaagagtacgttggaagacttcttaaaaaggctaaagatgatcatg aaagagaaatattcaaagtgttaa

DBGET integrated database retrieval system