Carlito syrichta (Philippine tarsier): 103264144 Help Entry 103264144         CDS       T07836                                  Symbol MAX Name (RefSeq) protein max isoform X1   KO K04453   Max protein Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr03083   Polycomb repressive complex csyr04010   MAPK signaling pathway csyr05200   Pathways in cancer csyr05202   Transcriptional misregulation in cancer csyr05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:csyr00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     103264144 (MAX)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103264144 (MAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103264144 (MAX)    05202 Transcriptional misregulation in cancer     103264144 (MAX)   09162 Cancer: specific types    05222 Small cell lung cancer     103264144 (MAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:csyr03000]     103264144 (MAX)    03036 Chromosome and associated proteins [BR:csyr03036]     103264144 (MAX) Transcription factors [BR:csyr03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     103264144 (MAX) Chromosome and associated proteins [BR:csyr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      103264144 (MAX) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HLH JetA bZIP_2 Filament JAKMIP_CC3 bHLH_INO4 SlyX PUMA_CC ATG16 GAGA_bind DUF7801 SLX9 Motif Other DBs NCBI-GeneID:  103264144 NCBI-ProteinID:  XP_021569982 Ensembl:  ENSTSYG00000034770 UniProt:  A0A3Q0E4Z9 LinkDB All DBs Position Unknown AA seq 190 aa AA seqDB search MGLVVFLEVHGQSVRTAGTTSPGGPCATSPVTWQGVDLACVPPLIRCCSEEADKRAHHNA LERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKR QNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQ NRKKLRMEAS NT seq 573 nt NT seq  +upstreamnt  +downstreamnt atgggacttgtagttttcttggaggtacatgggcagtctgtcagaacggccggaactaca agccccggtggcccctgcgcgacgagcccggtcacgtggcagggggtcgacctggcgtgc gtgccgccgttgatccggtgctgcagtgaggaggctgacaaacgggctcatcataatgca ctggaacgaaaacgtagggaccacatcaaggatagctttcacagtttgcgggactcggtc ccatcactccaaggagagaaggcatcccgggcccaaatcctagacaaagccacagagtat atccagtatatgagaaggaaaaaccacacacaccagcaggacattgatgacctcaagcgg cagaacgctcttctggagcagcaagtccgtgcactggagaaggcgaggtcaagtgcccaa ctgcagaccaactacccctcctcagacaacagcctctacaccaacgccaagggcagcacc atctctgccttcgatgggggctcggattccagctcggagtcggagccggaagagccccag aaccggaagaagcttcggatggaggccagctaa

DBGET integrated database retrieval system