Carlito syrichta (Philippine tarsier): 103264423 Help Entry 103264423         CDS       T07836                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr01522   Endocrine resistance csyr04110   Cell cycle csyr04115   p53 signaling pathway csyr04151   PI3K-Akt signaling pathway csyr04218   Cellular senescence csyr04530   Tight junction csyr04660   T cell receptor signaling pathway csyr04933   AGE-RAGE signaling pathway in diabetic complications csyr04934   Cushing syndrome csyr05160   Hepatitis C csyr05162   Measles csyr05163   Human cytomegalovirus infection csyr05164   Influenza A csyr05165   Human papillomavirus infection csyr05166   Human T-cell leukemia virus 1 infection csyr05167   Kaposi sarcoma-associated herpesvirus infection csyr05169   Epstein-Barr virus infection csyr05200   Pathways in cancer csyr05203   Viral carcinogenesis csyr05212   Pancreatic cancer csyr05214   Glioma csyr05218   Melanoma csyr05219   Bladder cancer csyr05220   Chronic myeloid leukemia csyr05222   Small cell lung cancer csyr05223   Non-small cell lung cancer csyr05224   Breast cancer csyr05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:csyr00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     103264423 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     103264423 (CDK4)    04115 p53 signaling pathway     103264423 (CDK4)    04218 Cellular senescence     103264423 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     103264423 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     103264423 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103264423 (CDK4)    05203 Viral carcinogenesis     103264423 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     103264423 (CDK4)    05225 Hepatocellular carcinoma     103264423 (CDK4)    05214 Glioma     103264423 (CDK4)    05220 Chronic myeloid leukemia     103264423 (CDK4)    05218 Melanoma     103264423 (CDK4)    05219 Bladder cancer     103264423 (CDK4)    05224 Breast cancer     103264423 (CDK4)    05222 Small cell lung cancer     103264423 (CDK4)    05223 Non-small cell lung cancer     103264423 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103264423 (CDK4)    05160 Hepatitis C     103264423 (CDK4)    05164 Influenza A     103264423 (CDK4)    05162 Measles     103264423 (CDK4)    05163 Human cytomegalovirus infection     103264423 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     103264423 (CDK4)    05169 Epstein-Barr virus infection     103264423 (CDK4)    05165 Human papillomavirus infection     103264423 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     103264423 (CDK4)    04934 Cushing syndrome     103264423 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     103264423 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:csyr01001]     103264423 (CDK4) Enzymes [BR:csyr01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      103264423 (CDK4) Protein kinases [BR:csyr01001]  Serine/threonine kinases: CMGC group   CDK family    103264423 (CDK4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo Haspin_kinase ABC1 Kinase-like Motif Other DBs NCBI-GeneID:  103264423 NCBI-ProteinID:  XP_008060281 Ensembl:  ENSTSYG00000011937 UniProt:  A0A1U7U309 LinkDB All DBs Position Unknown AA seq 303 aa AA seqDB search MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPVSTVREVALL RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSSGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG NPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctacctctcgatatgagccagtggctgaaattggtgttggtgcctacgggacggtg tacaaggcccgcgatccccacagtgggcacttcgtggccctcaagagtgtgcgagtcccc aatggaggaggagctggagggggcctccccgtcagcacagttcgggaggtggctttgctg aggcgcctggaggcctttgagcatcccaacgttgtccggctgatggacgtctgtgccacc tcccgaaccgaccgggagatcaaggtaaccctggtgtttgagcatatagaccaagaccta aggacatacctggataaggcacccccgccaggcttgccagtggagaccatcaaggatctg atgcgccagtttctaagaggcctggatttccttcatgccaattgcatcgttcatcgagat ctgaagccagagaacattctggtgacaagcagtgggacagtcaagctggctgactttggc ctggccagaatctacagctaccagatggcgcttacacctgtggttgtcacactctggtat cgagctcccgaagtgcttctgcagtcaacatacgcaacacccgtcgacatgtggagcgtt ggctgtatctttgcagagatgtttcgtcgaaagcctcttttctgtggaaactctgaagcc gaccagttgggcaaaatctttgacctgattgggctccctccagaggatgactggccccga gatgtgtctctgccgcggggagccttcccccccagggggccccgcccggtgcagtcggtg gtgcctgagatggaggagtctggagcacagcttctgctggagatgctgacttttaaccca cacaagcgaatctctgccttccgagcgctgcagcactcctatctgcataaggatgaaggt aatccggagtga

DBGET integrated database retrieval system