Carlito syrichta (Philippine tarsier): 103266203 Help Entry 103266203         CDS       T07836                                  Symbol NPPA Name (RefSeq) natriuretic peptides A   KO K12334   natriuretic peptide A Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04022   cGMP-PKG signaling pathway csyr04024   cAMP signaling pathway csyr04066   HIF-1 signaling pathway csyr04081   Hormone signaling csyr04270   Vascular smooth muscle contraction csyr04714   Thermogenesis csyr04921   Oxytocin signaling pathway csyr04923   Regulation of lipolysis in adipocytes csyr04924   Renin secretion csyr04925   Aldosterone synthesis and secretion csyr05143   African trypanosomiasis Brite KEGG Orthology (KO) [BR:csyr00001]  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     103266203 (NPPA)    04024 cAMP signaling pathway     103266203 (NPPA)    04022 cGMP-PKG signaling pathway     103266203 (NPPA)   09133 Signaling molecules and interaction    04081 Hormone signaling     103266203 (NPPA)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     103266203 (NPPA)    04921 Oxytocin signaling pathway     103266203 (NPPA)    04924 Renin secretion     103266203 (NPPA)    04925 Aldosterone synthesis and secretion     103266203 (NPPA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     103266203 (NPPA)   09159 Environmental adaptation    04714 Thermogenesis     103266203 (NPPA)  09160 Human Diseases   09174 Infectious disease: parasitic    05143 African trypanosomiasis     103266203 (NPPA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csyr04052]     103266203 (NPPA) Cytokines and neuropeptides [BR:csyr04052]  Neuropeptides   Unclassified    103266203 (NPPA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  103266203 NCBI-ProteinID:  XP_008062018 Ensembl:  ENSTSYG00000034521 UniProt:  A0A1U7TZW9 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MGSFSATTMSFLLFLALQLPGPDGANPVYNAMSEADLMNFKDLLDHLEDKMPLEDEAVPP QVLSEQNDEVGGALSPLAEVLPWTGEASPAQRDEGALRRSPWDSANRSANLKNRLRTMLS LPRSLRRSSCFGGRIDRIGAQSGLGCNSFRYRR NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgggctccttctcggccaccaccatgagcttcctcctcttcctggcactccagctgccg ggtccagatggagctaatcctgtgtacaacgccatgtctgaggcagacctaatgaatttc aaggatttgctggaccacttggaggacaagatgcctttagaagatgaggccgtgcctcca caagtgctgagcgagcagaatgatgaagtggggggagccctcagccccctcgctgaggtg cttccctggaccggggaggccagccctgcccagagagacgagggtgccctcaggcggagc ccctgggactccgccaacagatctgcgaacctgaaaaataggctgaggacgatgctctct ctgccccgaagcctgcggaggtccagctgttttgggggcaggatcgacaggatcggagcc cagagtggactgggctgcaacagcttccggtaccgaagataa

DBGET integrated database retrieval system