Carlito syrichta (Philippine tarsier): 103266527 Help Entry 103266527         CDS       T07836                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr01522   Endocrine resistance csyr04010   MAPK signaling pathway csyr04024   cAMP signaling pathway csyr04210   Apoptosis csyr04380   Osteoclast differentiation csyr04620   Toll-like receptor signaling pathway csyr04657   IL-17 signaling pathway csyr04658   Th1 and Th2 cell differentiation csyr04659   Th17 cell differentiation csyr04660   T cell receptor signaling pathway csyr04662   B cell receptor signaling pathway csyr04668   TNF signaling pathway csyr04713   Circadian entrainment csyr04725   Cholinergic synapse csyr04728   Dopaminergic synapse csyr04915   Estrogen signaling pathway csyr04917   Prolactin signaling pathway csyr04921   Oxytocin signaling pathway csyr04926   Relaxin signaling pathway csyr04928   Parathyroid hormone synthesis, secretion and action csyr04932   Non-alcoholic fatty liver disease csyr04935   Growth hormone synthesis, secretion and action csyr05031   Amphetamine addiction csyr05132   Salmonella infection csyr05133   Pertussis csyr05135   Yersinia infection csyr05140   Leishmaniasis csyr05142   Chagas disease csyr05161   Hepatitis B csyr05162   Measles csyr05166   Human T-cell leukemia virus 1 infection csyr05167   Kaposi sarcoma-associated herpesvirus infection csyr05170   Human immunodeficiency virus 1 infection csyr05171   Coronavirus disease - COVID-19 csyr05200   Pathways in cancer csyr05207   Chemical carcinogenesis - receptor activation csyr05208   Chemical carcinogenesis - reactive oxygen species csyr05210   Colorectal cancer csyr05224   Breast cancer csyr05231   Choline metabolism in cancer csyr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer csyr05323   Rheumatoid arthritis csyr05417   Lipid and atherosclerosis csyr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:csyr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103266527 (FOS)    04668 TNF signaling pathway     103266527 (FOS)    04024 cAMP signaling pathway     103266527 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     103266527 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103266527 (FOS)    04660 T cell receptor signaling pathway     103266527 (FOS)    04658 Th1 and Th2 cell differentiation     103266527 (FOS)    04659 Th17 cell differentiation     103266527 (FOS)    04657 IL-17 signaling pathway     103266527 (FOS)    04662 B cell receptor signaling pathway     103266527 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     103266527 (FOS)    04917 Prolactin signaling pathway     103266527 (FOS)    04921 Oxytocin signaling pathway     103266527 (FOS)    04926 Relaxin signaling pathway     103266527 (FOS)    04935 Growth hormone synthesis, secretion and action     103266527 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     103266527 (FOS)   09156 Nervous system    04725 Cholinergic synapse     103266527 (FOS)    04728 Dopaminergic synapse     103266527 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     103266527 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     103266527 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103266527 (FOS)    05207 Chemical carcinogenesis - receptor activation     103266527 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     103266527 (FOS)    05231 Choline metabolism in cancer     103266527 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103266527 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     103266527 (FOS)    05224 Breast cancer     103266527 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103266527 (FOS)    05170 Human immunodeficiency virus 1 infection     103266527 (FOS)    05161 Hepatitis B     103266527 (FOS)    05171 Coronavirus disease - COVID-19     103266527 (FOS)    05162 Measles     103266527 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     103266527 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     103266527 (FOS)    05135 Yersinia infection     103266527 (FOS)    05133 Pertussis     103266527 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     103266527 (FOS)    05142 Chagas disease     103266527 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     103266527 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     103266527 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103266527 (FOS)    05418 Fluid shear stress and atherosclerosis     103266527 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     103266527 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     103266527 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:csyr03000]     103266527 (FOS)    04131 Membrane trafficking [BR:csyr04131]     103266527 (FOS) Transcription factors [BR:csyr03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     103266527 (FOS) Membrane trafficking [BR:csyr04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     103266527 (FOS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  103266527 NCBI-ProteinID:  XP_008062347 Ensembl:  ENSTSYG00000013658 UniProt:  A0A1U7UAQ4 LinkDB All DBs Position Unknown AA seq 379 aa AA seqDB search MMFSAFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPGTAQDFCADLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPASGAYSRAGVVKSVAGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLGGGLPEAAAPESEEAFA LPLLSDPEPKPSAEPGKSLGSMELKAEPFDDFLFPASSRPGGSETARSVPDVDLSGSFYA ADWEPLNSGSLGMGPLAAELEPLCTPVVTCTPGTTYTSSFVFTYPEADSFPSCAAAHRKG SSSNEPSSDSLSSPTLLAL NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt atgatgttctcggccttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcg tccccagccggggacagcctctcctactaccattcgcccgcggactccttctccagcatg ggctcgcccggcaccgcgcaggacttctgcgcagacctggccgtctccagcgccaacttc atccccacggtgaccgccatctccaccagcccggacctgcagtggctagtgcagcccacc ctggtctcctccgtggccccgtcgcagaccagagccccccacccctacggcgtccccacc cccgcgtccggggcttactcgagggccggagtcgtgaagagcgtggcaggaggccgagcg cagagcatcggcaggaggggcaaggtggaacagttgtctccagaagaagaggagaaaagg agaatccgaagggaaaggaataagatggctgcagccaagtgccgcaaccgccggagggag ctgacggacacactccaagcggagacggaccagctagaggacgagaagtctgccctgcag accgagatcgccaacctgctgaaggagaaagaaaagctggagttcatcctggcagcgcac cggcccgcctgcaagatccccgacgacctgggtttcccggaagagatgtccgtggcttcc cttgacctgggcgggggcttgccggaggctgccgccccggagtccgaggaggccttcgcg ctgccgctgctcagcgaccccgagcccaagccctcggcggagcccggcaagagcctgggc agcatggagctgaaggccgagcccttcgacgacttcctgttccccgcgtcgtcccggccc ggcggctccgagacggcccgctccgtgcccgacgtggacctgtctggctccttctatgca gcagactgggagcccctgaacagcggctctctaggcatggggcccctggccgcagagctg gagcccctgtgcaccccggtggtcacctgtacccccggcacgacctacacgtcttccttc gtcttcacctaccccgaggctgactccttccccagctgcgcggccgcccaccgcaagggc agcagcagcaacgagccctcctcggactcgctcagctcccccacgctgctggccctgtga

DBGET integrated database retrieval system