Carlito syrichta (Philippine tarsier): 103268608 Help Entry 103268608         CDS       T07836                                  Symbol IL6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr01521   EGFR tyrosine kinase inhibitor resistance csyr01523   Antifolate resistance csyr04060   Cytokine-cytokine receptor interaction csyr04061   Viral protein interaction with cytokine and cytokine receptor csyr04066   HIF-1 signaling pathway csyr04068   FoxO signaling pathway csyr04151   PI3K-Akt signaling pathway csyr04218   Cellular senescence csyr04620   Toll-like receptor signaling pathway csyr04621   NOD-like receptor signaling pathway csyr04623   Cytosolic DNA-sensing pathway csyr04625   C-type lectin receptor signaling pathway csyr04630   JAK-STAT signaling pathway csyr04640   Hematopoietic cell lineage csyr04657   IL-17 signaling pathway csyr04659   Th17 cell differentiation csyr04668   TNF signaling pathway csyr04672   Intestinal immune network for IgA production csyr04931   Insulin resistance csyr04932   Non-alcoholic fatty liver disease csyr04933   AGE-RAGE signaling pathway in diabetic complications csyr04936   Alcoholic liver disease csyr05010   Alzheimer disease csyr05020   Prion disease csyr05022   Pathways of neurodegeneration - multiple diseases csyr05132   Salmonella infection csyr05133   Pertussis csyr05134   Legionellosis csyr05135   Yersinia infection csyr05142   Chagas disease csyr05143   African trypanosomiasis csyr05144   Malaria csyr05146   Amoebiasis csyr05152   Tuberculosis csyr05161   Hepatitis B csyr05162   Measles csyr05163   Human cytomegalovirus infection csyr05164   Influenza A csyr05166   Human T-cell leukemia virus 1 infection csyr05167   Kaposi sarcoma-associated herpesvirus infection csyr05168   Herpes simplex virus 1 infection csyr05169   Epstein-Barr virus infection csyr05171   Coronavirus disease - COVID-19 csyr05200   Pathways in cancer csyr05202   Transcriptional misregulation in cancer csyr05321   Inflammatory bowel disease csyr05323   Rheumatoid arthritis csyr05332   Graft-versus-host disease csyr05410   Hypertrophic cardiomyopathy csyr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:csyr00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     103268608 (IL6)    04668 TNF signaling pathway     103268608 (IL6)    04066 HIF-1 signaling pathway     103268608 (IL6)    04068 FoxO signaling pathway     103268608 (IL6)    04151 PI3K-Akt signaling pathway     103268608 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103268608 (IL6)    04061 Viral protein interaction with cytokine and cytokine receptor     103268608 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     103268608 (IL6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     103268608 (IL6)    04620 Toll-like receptor signaling pathway     103268608 (IL6)    04621 NOD-like receptor signaling pathway     103268608 (IL6)    04623 Cytosolic DNA-sensing pathway     103268608 (IL6)    04625 C-type lectin receptor signaling pathway     103268608 (IL6)    04659 Th17 cell differentiation     103268608 (IL6)    04657 IL-17 signaling pathway     103268608 (IL6)    04672 Intestinal immune network for IgA production     103268608 (IL6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103268608 (IL6)    05202 Transcriptional misregulation in cancer     103268608 (IL6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103268608 (IL6)    05161 Hepatitis B     103268608 (IL6)    05171 Coronavirus disease - COVID-19     103268608 (IL6)    05164 Influenza A     103268608 (IL6)    05162 Measles     103268608 (IL6)    05168 Herpes simplex virus 1 infection     103268608 (IL6)    05163 Human cytomegalovirus infection     103268608 (IL6)    05167 Kaposi sarcoma-associated herpesvirus infection     103268608 (IL6)    05169 Epstein-Barr virus infection     103268608 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     103268608 (IL6)    05135 Yersinia infection     103268608 (IL6)    05133 Pertussis     103268608 (IL6)    05134 Legionellosis     103268608 (IL6)    05152 Tuberculosis     103268608 (IL6)   09174 Infectious disease: parasitic    05146 Amoebiasis     103268608 (IL6)    05144 Malaria     103268608 (IL6)    05142 Chagas disease     103268608 (IL6)    05143 African trypanosomiasis     103268608 (IL6)   09163 Immune disease    05323 Rheumatoid arthritis     103268608 (IL6)    05321 Inflammatory bowel disease     103268608 (IL6)    05332 Graft-versus-host disease     103268608 (IL6)   09164 Neurodegenerative disease    05010 Alzheimer disease     103268608 (IL6)    05020 Prion disease     103268608 (IL6)    05022 Pathways of neurodegeneration - multiple diseases     103268608 (IL6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103268608 (IL6)    05410 Hypertrophic cardiomyopathy     103268608 (IL6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     103268608 (IL6)    04932 Non-alcoholic fatty liver disease     103268608 (IL6)    04931 Insulin resistance     103268608 (IL6)    04933 AGE-RAGE signaling pathway in diabetic complications     103268608 (IL6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     103268608 (IL6)    01523 Antifolate resistance     103268608 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csyr04052]     103268608 (IL6) Cytokines and neuropeptides [BR:csyr04052]  Cytokines   Interleukins    103268608 (IL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 IL23 DUF4931_N Motif Other DBs NCBI-GeneID:  103268608 NCBI-ProteinID:  XP_008064388 Ensembl:  ENSTSYG00000035078 UniProt:  A0A1U7U6M6 LinkDB All DBs Position Unknown AA seq 209 aa AA seqDB search MNSLSTSTLGPVAFSLGLFLVMAAAFPTTPRPLGEDSTDAAPSNRPSYTTPEHIEELIKR ILGLAKEMCQKSFGCDNSREVLAGNNLNLPKMEKEDGCFESGFNKETCLKKITTGLLEFQ VYLEYLQNKFEGNKEHAETVLIGTKAMIQYLKTKVKNPDAVATPDPTANAILLVKLKSQG QWLQNTTIHLILRSLIHFLHSSARAIRVK NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atgaactccctctccacaagcaccctcggcccagttgccttctccctggggctgttcctg gtgatggccgcagccttccccaccaccccaagacccctgggagaagattccacagatgct gccccctcaaacagaccatcctacaccactccagaacacatcgaagagctcattaagaga atcttgggcctggcaaaggagatgtgtcaaaagagttttgggtgtgacaacagcagggag gtactggcaggaaacaacctgaaccttccaaagatggaaaaagaagatggatgcttcgaa tctggattcaataaggagacttgtctgaagaagatcactacgggtcttttggagtttcag gtatacctggaatacctccagaacaagtttgagggtaataaggaacacgctgaaaccgtg ctgataggtaccaaagccatgatccagtacctgaagaccaaggtaaagaacccagacgca gtagccacccctgacccaactgccaatgccatcctgctggtgaagctgaagtcgcaaggc cagtggctgcagaatacaaccatccatctcatccttcgcagcctgattcacttcctgcac tccagcgcaagggccattcgggtcaagtag

DBGET integrated database retrieval system