Carlito syrichta (Philippine tarsier): 103274703 Help Entry 103274703         CDS       T07836                                  Symbol BCL2 Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr01521   EGFR tyrosine kinase inhibitor resistance csyr01522   Endocrine resistance csyr01524   Platinum drug resistance csyr04064   NF-kappa B signaling pathway csyr04066   HIF-1 signaling pathway csyr04071   Sphingolipid signaling pathway csyr04115   p53 signaling pathway csyr04140   Autophagy - animal csyr04141   Protein processing in endoplasmic reticulum csyr04151   PI3K-Akt signaling pathway csyr04210   Apoptosis csyr04215   Apoptosis - multiple species csyr04217   Necroptosis csyr04261   Adrenergic signaling in cardiomyocytes csyr04340   Hedgehog signaling pathway csyr04510   Focal adhesion csyr04621   NOD-like receptor signaling pathway csyr04630   JAK-STAT signaling pathway csyr04722   Neurotrophin signaling pathway csyr04725   Cholinergic synapse csyr04915   Estrogen signaling pathway csyr04928   Parathyroid hormone synthesis, secretion and action csyr04933   AGE-RAGE signaling pathway in diabetic complications csyr05014   Amyotrophic lateral sclerosis csyr05022   Pathways of neurodegeneration - multiple diseases csyr05132   Salmonella infection csyr05145   Toxoplasmosis csyr05152   Tuberculosis csyr05161   Hepatitis B csyr05162   Measles csyr05168   Herpes simplex virus 1 infection csyr05169   Epstein-Barr virus infection csyr05170   Human immunodeficiency virus 1 infection csyr05200   Pathways in cancer csyr05206   MicroRNAs in cancer csyr05207   Chemical carcinogenesis - receptor activation csyr05210   Colorectal cancer csyr05215   Prostate cancer csyr05222   Small cell lung cancer csyr05226   Gastric cancer csyr05417   Lipid and atherosclerosis csyr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:csyr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103274703 (BCL2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     103274703 (BCL2)    04630 JAK-STAT signaling pathway     103274703 (BCL2)    04064 NF-kappa B signaling pathway     103274703 (BCL2)    04066 HIF-1 signaling pathway     103274703 (BCL2)    04071 Sphingolipid signaling pathway     103274703 (BCL2)    04151 PI3K-Akt signaling pathway     103274703 (BCL2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103274703 (BCL2)   09143 Cell growth and death    04210 Apoptosis     103274703 (BCL2)    04215 Apoptosis - multiple species     103274703 (BCL2)    04217 Necroptosis     103274703 (BCL2)    04115 p53 signaling pathway     103274703 (BCL2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103274703 (BCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103274703 (BCL2)   09152 Endocrine system    04915 Estrogen signaling pathway     103274703 (BCL2)    04928 Parathyroid hormone synthesis, secretion and action     103274703 (BCL2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     103274703 (BCL2)   09156 Nervous system    04725 Cholinergic synapse     103274703 (BCL2)    04722 Neurotrophin signaling pathway     103274703 (BCL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103274703 (BCL2)    05206 MicroRNAs in cancer     103274703 (BCL2)    05207 Chemical carcinogenesis - receptor activation     103274703 (BCL2)   09162 Cancer: specific types    05210 Colorectal cancer     103274703 (BCL2)    05226 Gastric cancer     103274703 (BCL2)    05215 Prostate cancer     103274703 (BCL2)    05222 Small cell lung cancer     103274703 (BCL2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103274703 (BCL2)    05161 Hepatitis B     103274703 (BCL2)    05162 Measles     103274703 (BCL2)    05168 Herpes simplex virus 1 infection     103274703 (BCL2)    05169 Epstein-Barr virus infection     103274703 (BCL2)   09171 Infectious disease: bacterial    05132 Salmonella infection     103274703 (BCL2)    05152 Tuberculosis     103274703 (BCL2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     103274703 (BCL2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     103274703 (BCL2)    05022 Pathways of neurodegeneration - multiple diseases     103274703 (BCL2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103274703 (BCL2)    05418 Fluid shear stress and atherosclerosis     103274703 (BCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     103274703 (BCL2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     103274703 (BCL2)    01524 Platinum drug resistance     103274703 (BCL2)    01522 Endocrine resistance     103274703 (BCL2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:csyr01009]     103274703 (BCL2) Protein phosphatases and associated proteins [BR:csyr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      103274703 (BCL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 ARMH5 Bcl-2_3 Motif Other DBs NCBI-GeneID:  103274703 NCBI-ProteinID:  XP_021561642 UniProt:  A0A3Q0DH24 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MAHAGRTGYDNREIVRKYIHYKLAQRGYEWEAGDAGAAAPGVAPARDVSSSQPGHTRGRF ATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQ DNGGWVGACLVDARRGVRSRWVSDGWARGPQPHSYLARRCWVQQLMNQVPKINVAPLPGK PSCVLERDCLLRFRMNRSLVTLKELAKG NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggcgcacgccgggagaacagggtatgataaccgggagatagtgaggaagtacatccac tataagctggcgcagaggggctacgagtgggaggccggagacgcgggcgccgcggccccc ggggtcgcccctgcgcgggacgtctcctcctcccagcccgggcacacgaggggacgcttt gccacggtggtggaggagctcttcagggacggggtgaactgggggaggattgtggccttc tttgagttcggtggggtcatgtgtgtggagagcgtcaaccgggagatgtcgcccctggtg gacaacatcgccctgtggatgactgagtacctgaaccggcacctgcacacctggatccag gataacggaggctgggtaggtgcatgcttggtggatgcgcgtcggggcgtgaggtctcgg tgggtctcagatggttgggccagaggtccccagcctcacagttacctggcccggcgctgc tgggtgcagcaacttatgaaccaggtcccaaaaatcaatgtagcccctctccctggaaaa cctagttgtgttttggagagagattgtttgttgagattccgcatgaacagatctttagtc actctgaaagaacttgccaaagggtga

DBGET integrated database retrieval system