Chlamydia trachomatis L2/434/Bu: CTL0876 Help Entry CTL0876           CDS       T00645                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism ctb  Chlamydia trachomatis L2/434/Bu Pathway ctb00670   One carbon pool by folate ctb00790   Folate biosynthesis ctb01100   Metabolic pathways ctb01240   Biosynthesis of cofactors ctb04981   Folate transport and metabolism Module ctb_M00840   Tetrahydrofolate biosynthesis, mediated by ribA and trpF, GTP => THF Brite KEGG Orthology (KO) [BR:ctb00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CTL0876 (folA)    00670 One carbon pool by folate     CTL0876 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     CTL0876 (folA) Enzymes [BR:ctb01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      CTL0876 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  CAP04313 UniProt:  A0A0H3MLJ3 LinkDB All DBs Position complement(1010381..1010860) Genome browser AA seq 159 aa AA seqDB search MIQATGIVAIDPRGVMGALGKLPWSYPEDLRFFAETIRNHPIIMGRKTWESLPDKYKHGR DIVVFSRRMHPPQCIGVSSFAEYGTLSLNHPFLIGGAELFESFFQQNLLKACFVTHIKKK YWGDTFFPITRLSGWKKECICNTEDFSIYYYENNSDQNT NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgatccaagcaacaggtatcgttgctattgatcccagaggagtgatgggagctttaggc aagctcccttggagttatcccgaagatctacgtttttttgcagaaaccattcgaaatcat cccatcattatgggacgaaagacttgggagtctcttccagacaagtataagcatgggcgg gatatcgttgtcttttctcgcaggatgcatccaccacaatgcataggagtttcttccttt gcagagtatgggacactatctttgaatcatccgtttttaattgggggagcggagctcttt gaaagttttttccaacaaaaccttctgaaagcttgttttgtcacacatatcaaaaagaaa tattggggcgatactttcttccctatcacgcgattatcaggatggaagaaggaatgtatt tgtaatacagaggatttcagtatttattattatgaaaataactccgatcaaaacacgtaa

DBGET integrated database retrieval system