Chlamydia trachomatis D/UW-3/CX: CT_612 Help Entry CT_612            CDS       T00017                                  Symbol folA Name (RefSeq) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism ctr  Chlamydia trachomatis D/UW-3/CX Pathway ctr00670   One carbon pool by folate ctr00790   Folate biosynthesis ctr01100   Metabolic pathways ctr01240   Biosynthesis of cofactors ctr04981   Folate transport and metabolism Module ctr_M00840   Tetrahydrofolate biosynthesis, mediated by ribA and trpF, GTP => THF Brite KEGG Orthology (KO) [BR:ctr00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CT_612 (folA)    00670 One carbon pool by folate     CT_612 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     CT_612 (folA) Enzymes [BR:ctr01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      CT_612 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-GeneID:  884394 NCBI-ProteinID:  NP_220129 UniProt:  O84618 LinkDB All DBs Position complement(691821..692300) Genome browser AA seq 159 aa AA seqDB search MIQATGIVAIDPRGVMGALGKLPWSYPEDLRFFAETIRNHPIIMGRKTWESLPDKYKHGR DIVVFSRRMHPPQCIGVSSFAEYGTLSLNHPFLIGGAELFESFFQQNLLKACFVTHIKKE YWGDTFFPITRLSGWKKECICNTEDFSIYYYENNSDQNT NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgatccaagcaacaggtatcgttgctattgatcccagaggagtgatgggagctttaggc aagctcccttggagttatcccgaagatctacgtttttttgcagaaaccattcgaaatcat cccatcattatgggacgaaagacttgggagtctcttccagacaagtataagcatgggcgg gatatcgttgtcttttctcgcaggatgcatccaccacaatgcataggagtttcttccttt gcagagtatgggacactatctttgaatcatccgtttttaattgggggagcggagctcttt gaaagttttttccaacaaaaccttctgaaagcttgttttgtcacacatatcaaaaaggaa tattggggcgatactttcttccctatcacgcgattatcaggatggaagaaggaatgtatt tgtaatacagaggatttcagtatttattattatgaaaataactccgatcaaaacacgtaa

DBGET integrated database retrieval system