Chlamydia trachomatis B/TZ1A828/OT: CTB_6161 Help Entry CTB_6161          CDS       T01327                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism ctz  Chlamydia trachomatis B/TZ1A828/OT Pathway ctz00670   One carbon pool by folate ctz00790   Folate biosynthesis ctz01100   Metabolic pathways ctz01240   Biosynthesis of cofactors ctz04981   Folate transport and metabolism Module ctz_M00840   Tetrahydrofolate biosynthesis, mediated by ribA and trpF, GTP => THF Brite KEGG Orthology (KO) [BR:ctz00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CTB_6161 (folA)    00670 One carbon pool by folate     CTB_6161 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     CTB_6161 (folA) Enzymes [BR:ctz01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      CTB_6161 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  CAX10177 LinkDB All DBs Position complement(694350..694829) Genome browser AA seq 159 aa AA seqDB search MIQATGIVAIDPRGVMGALGKLPWSYPEDLRFFAETIRNHPIIMGRKTWESLPDKYKHGR DIVVFSRRMHPPQCIGVSSFAEYGTLSLNHPFLIGGAELFESFFQQNLLKACFVTHIKKE YWGDTFFPITRLSGWKKECICNTEDFSIYYYENNSDQNT NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgatccaagcaacaggtatcgttgctattgatcccagaggagtgatgggagctttaggc aagctcccttggagttatcccgaagatctacgtttttttgcagaaaccattcgaaatcat cccatcattatgggacgaaagacttgggagtctcttccagacaagtataagcatgggcgg gatatcgttgtcttttctcgcaggatgcatccaccacaatgcataggagtttcttccttt gcagagtatgggacactatctttgaatcatccgtttttaattgggggagcggagctcttt gaaagttttttccaacaaaaccttctgaaagcttgttttgtcacacatatcaaaaaggaa tattggggcgatactttcttccctatcacgcgattatcaggatggaagaaggaatgtatt tgtaatacagaggatttcagtatttattattatgaaaataactccgatcaaaacacgtaa

DBGET integrated database retrieval system