Cuculus canorus (common cuckoo): 104055502 Help Entry 104055502         CDS       T08597                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism cuca  Cuculus canorus (common cuckoo) Pathway cuca03420   Nucleotide excision repair cuca04110   Cell cycle cuca04114   Oocyte meiosis cuca04120   Ubiquitin mediated proteolysis cuca04141   Protein processing in endoplasmic reticulum cuca04310   Wnt signaling pathway cuca04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:cuca00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104055502 (RBX1)    04120 Ubiquitin mediated proteolysis     104055502 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     104055502 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     104055502 (RBX1)    04350 TGF-beta signaling pathway     104055502 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     104055502 (RBX1)    04114 Oocyte meiosis     104055502 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cuca04121]     104055502 (RBX1)    03400 DNA repair and recombination proteins [BR:cuca03400]     104055502 (RBX1) Enzymes [BR:cuca01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      104055502 (RBX1) Ubiquitin system [BR:cuca04121]  Ubiquitin ligases (E3)   UBL E3 ligases    104055502 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      104055502 (RBX1)    Cul2 complex      104055502 (RBX1)    Cul3 complex      104055502 (RBX1)    Cul4 complex      104055502 (RBX1)    Cul7 complex      104055502 (RBX1)    Cul8 complex      104055502 (RBX1)    Cul9 complex      104055502 (RBX1) DNA repair and recombination proteins [BR:cuca03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       104055502 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       104055502 (RBX1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  104055502 NCBI-ProteinID:  XP_053912405 LinkDB All DBs Position 1:155344187..155356760 Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggctgcaatggatgtggacacccctagcggcaccaacagcggcgccggcaagaag cgcttcgaagtgaagaaatggaacgcagtagctctgtgggcatgggacatcgtggttgat aactgtgccatttgcagaaaccatattatggatctatgcatagaatgtcaagcaaaccaa gcatcagctacctctgaagagtgcacagttgcatggggcgtctgcaatcatgctttccac ttccactgcatctctcgctggctcaaaactcgccaagtatgtccgctggacaacagggaa tgggagttccaaaaatatggacactag

DBGET integrated database retrieval system