Cheilinus undulatus (humphead wrasse): 121515226 Help Entry 121515226         CDS       T07473                                  Symbol tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism cud  Cheilinus undulatus (humphead wrasse) Pathway cud00510   N-Glycan biosynthesis cud00513   Various types of N-glycan biosynthesis cud04141   Protein processing in endoplasmic reticulum Module cud_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:cud00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     121515226 (tmem258)    00513 Various types of N-glycan biosynthesis     121515226 (tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     121515226 (tmem258) SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  121515226 NCBI-ProteinID:  XP_041651822 LinkDB All DBs AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaactcgaagcaatgaccagatacaccagcccggtgaacccggctgtgttccctcac cttactgtcgtccttctggccatcggcatgttcttcaccgcctggttcttcgtctatgag gttacatccacgaaatacacccgggacgtctacaaagagctgctgatctcccttgtggca tcacttttcatgggctttggtgtactatttttactactctgggttgggatctatgtataa

DBGET integrated database retrieval system