Charadrius vociferus (killdeer): 104288109 Help Entry 104288109         CDS       T08577                                  Symbol DHFR Name (RefSeq) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism cvf  Charadrius vociferus (killdeer) Pathway cvf00670   One carbon pool by folate cvf00790   Folate biosynthesis cvf01100   Metabolic pathways cvf01240   Biosynthesis of cofactors cvf04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:cvf00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     104288109 (DHFR)    00670 One carbon pool by folate     104288109 (DHFR)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     104288109 (DHFR) Enzymes [BR:cvf01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      104288109 (DHFR) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-GeneID:  104288109 NCBI-ProteinID:  XP_009885168 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MTSTSHVEGKQNALIMGKRTWFSIPEKNRPLKDRINIVLSRELKETPKGAHYLSKSLDDA LALLDSPELKSKVDMVWIVGGTSVYKAAMEKPINHRLFVTRILQEFESDTFFPEINYKDY KLLTEYPGVPADIQEENGIQYKFEVYEKAVLAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgacaagcacatcccacgtggaaggtaaacagaatgcactgataatgggtaaaagaacc tggttctccattcctgagaagaatcgtcctttaaaagacagaattaatatagtgcttagc cgggagctcaaggaaaccccaaaaggagcacattatctttccaaaagtctggatgatgct ttagctcttttggattcacccgaattaaaaagtaaagtagacatggtttggattgtcgga ggcacttcagtttacaaggcagcaatggagaagccaattaatcatcgattgtttgtgaca agaattttgcaggaatttgagagtgacacattttttccagaaatcaactacaaagactac aaacttctcacagagtacccaggtgtccctgctgatattcaagaagagaatggcatccag tacaaatttgaagtgtatgaaaaagctgtcttggcacaataa

DBGET integrated database retrieval system