Charadrius vociferus (killdeer): 104291981 Help Entry 104291981         CDS       T08577                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism cvf  Charadrius vociferus (killdeer) Pathway cvf04060   Cytokine-cytokine receptor interaction cvf04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:cvf00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104291981 (IL4)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     104291981 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cvf04052]     104291981 (IL4)    00536 Glycosaminoglycan binding proteins [BR:cvf00536]     104291981 (IL4) Cytokines and neuropeptides [BR:cvf04052]  Cytokines   Interleukins    104291981 (IL4) Glycosaminoglycan binding proteins [BR:cvf00536]  Heparan sulfate / Heparin   Cytokines    104291981 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 GlyL_C Motif Other DBs NCBI-GeneID:  104291981 NCBI-ProteinID:  XP_009889598 LinkDB All DBs Position Unknown AA seq 120 aa AA seqDB search MSIPVPVLLTFLVLSACQGHMAALVQTSTFLKESIRLLSELLETKVSCDKMNVTNIFAGD KKDDDLGILCKATTVALEGRSCHRHLEGVHLNLLSLVRRKSPVHKGCVSQGYSDYFSCPS NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgagcatcccggtcccggtcctgctcaccttcctggtgctgtcggcctgccagggccac atggccgctctggttcagacctccaccttcctgaaggagagcatcaggctgctgagcgag ctcctggagaccaaggtttcctgtgataagatgaacgtgacaaatatttttgcaggcgat aagaaagatgatgatctggggatcttgtgcaaagccaccacagtcgctttggagggccgg agctgccacaggcacctggagggcgttcacctcaacttgctcagcctggtccgaaggaaa agcccagtccacaagggctgcgtatcacagggctacagcgactattttagctgcccttcc tga

DBGET integrated database retrieval system