Synechococcus sp. JA-2-3B'a(2-13): CYB_1408 Help Entry CYB_1408          CDS       T00319                                  Symbol folB-1 Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism cyb  Synechococcus sp. JA-2-3B'a(2-13) Pathway cyb00790   Folate biosynthesis cyb01100   Metabolic pathways cyb01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:cyb00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CYB_1408 (folB-1) Enzymes [BR:cyb01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      CYB_1408 (folB-1)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      CYB_1408 (folB-1)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      CYB_1408 (folB-1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF29 Motif Other DBs NCBI-ProteinID:  ABD02376 UniProt:  Q2JLN1 LinkDB All DBs Position 1477034..1477390 Genome browser AA seq 118 aa AA seqDB search MRDRLIVSGLRYYGYTGLDEAERALGQWFEVDFELWADLRPAALSGQLCDSLDYRSAVAG IAELVKSNQFVLIESLAEAIAEMVLRETGASKAKIRLTKCHPPIPELTGRVTVEIVRP NT seq 357 nt NT seq  +upstreamnt  +downstreamnt ttgcgagatcggctgatcgtctccggcctgcgctactacggttataccggccttgatgag gcggaacgggctttggggcaatggtttgaggtggatttcgagttgtgggcggatctgcgc ccggctgctctcagcggccaactgtgtgatagcctcgactaccgttctgcagtggccggg attgcggaactggtgaaaagcaatcagtttgtgctgatcgagagcttggcggaggcgatt gccgaaatggtgctgcgggagacaggggccagcaaagctaagatccgattgaccaagtgt catcccccgatcccggagctgacggggcgggttactgtggagattgttcgtccctag

DBGET integrated database retrieval system