Drosophila ananassae: 6493370 Help Entry 6493370           CDS       T01059                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism dan  Drosophila ananassae Pathway dan00510   N-Glycan biosynthesis dan00513   Various types of N-glycan biosynthesis dan04141   Protein processing in endoplasmic reticulum Module dan_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:dan00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     6493370    00513 Various types of N-glycan biosynthesis     6493370  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     6493370 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 DUF4010 TctB CAAD DUF6404 Motif Other DBs NCBI-GeneID:  6493370 NCBI-ProteinID:  XP_001957622 UniProt:  B3M4D4 LinkDB All DBs Position Unknown AA seq 78 aa AA seqDB search MEVMKRYVSPVNPAVFPHLATVLLIIGTFFTAWFFIFVVSRKNSKESTLIKELLISLCAS IFLGFGIVFLLLTVGIYV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggaagtgatgaagcgctacgtatcgcctgtgaacccagccgttttcccccacctagcc accgttcttctgattattggaacctttttcaccgcctggttcttcatctttgtggtgtct cggaaaaactcaaaggaatccacgcttatcaaggagcttctgattagcctgtgcgcttcg atattcctgggattcggcattgtgttcctacttttaaccgtcggtatttacgtatga

DBGET integrated database retrieval system