Drosophila ananassae: 6496786 Help Entry 6496786           CDS       T01059                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dan  Drosophila ananassae Pathway dan03420   Nucleotide excision repair dan04120   Ubiquitin mediated proteolysis dan04141   Protein processing in endoplasmic reticulum dan04310   Wnt signaling pathway dan04341   Hedgehog signaling pathway - fly dan04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:dan00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     6496786    04120 Ubiquitin mediated proteolysis     6496786   09124 Replication and repair    03420 Nucleotide excision repair     6496786  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     6496786    04341 Hedgehog signaling pathway - fly     6496786    04350 TGF-beta signaling pathway     6496786  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dan04121]     6496786    03400 DNA repair and recombination proteins [BR:dan03400]     6496786 Enzymes [BR:dan01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      6496786 Ubiquitin system [BR:dan04121]  Ubiquitin ligases (E3)   UBL E3 ligases    6496786   Multi subunit type E3    SCF complex     Ring finger protein      6496786    Cul2 complex      6496786    Cul3 complex      6496786    Cul4 complex      6496786    Cul7 complex      6496786    Cul8 complex      6496786    Cul9 complex      6496786 DNA repair and recombination proteins [BR:dan03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       6496786     TCR (transcription coupled repair) factors      Cul4-CSA complex       6496786 SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  6496786 NCBI-ProteinID:  XP_001965770 UniProt:  A0AA97IQD8 B3MWR4 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MEVDEEEFEVPSSSSKGEKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggaggtcgatgaggaagagttcgaggtcccctccagcagcagcaaaggcgagaagaag cgcttcgaagtgaagaagtggaacgccgtagctctatgggcatgggacatcgtggtggat aattgcgccatttgccgcaaccacatcatggacttgtgcatcgagtgccaggctaaccag gcctcggccaccagcgaggagtgcacagtggcctggggcgtctgcaaccatgccttccac ttccactgcatctcccgttggctgaagacgcgtcaggtctgtccgttggacaatcgcgaa tgggacttccagaagtacggccactaa

DBGET integrated database retrieval system