Drosophila arizonae: 108620113 Help Entry 108620113         CDS       T05886                                  Name (RefSeq) RING-box protein 1b-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism daz  Drosophila arizonae Pathway daz03420   Nucleotide excision repair daz04120   Ubiquitin mediated proteolysis daz04141   Protein processing in endoplasmic reticulum daz04310   Wnt signaling pathway daz04341   Hedgehog signaling pathway - fly daz04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:daz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108620113    04120 Ubiquitin mediated proteolysis     108620113   09124 Replication and repair    03420 Nucleotide excision repair     108620113  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     108620113    04341 Hedgehog signaling pathway - fly     108620113    04350 TGF-beta signaling pathway     108620113  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:daz04121]     108620113    03400 DNA repair and recombination proteins [BR:daz03400]     108620113 Enzymes [BR:daz01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      108620113 Ubiquitin system [BR:daz04121]  Ubiquitin ligases (E3)   UBL E3 ligases    108620113   Multi subunit type E3    SCF complex     Ring finger protein      108620113    Cul2 complex      108620113    Cul3 complex      108620113    Cul4 complex      108620113    Cul7 complex      108620113    Cul8 complex      108620113    Cul9 complex      108620113 DNA repair and recombination proteins [BR:daz03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       108620113     TCR (transcription coupled repair) factors      Cul4-CSA complex       108620113 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-RING_16 zf-C3HC4 zf-RING_UBOX zf-RING_11 Motif Other DBs NCBI-GeneID:  108620113 NCBI-ProteinID:  XP_017872482 LinkDB All DBs Position X AA seq 98 aa AA seqDB search MKEFEKINNDATDEKSARFQIMNWNANAFWAWDIGVDTCAICRNHIDELCNECLSNMSVD CPKACGVCQHVYHYHCISRWLTKRHVCPLDYLAWQYKN NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaaagaatttgagaaaattaataatgatgccactgacgagaaaagcgcccgcttccaa ataatgaattggaatgccaatgctttttgggcttgggatattggggttgatacttgcgcc atttgtcgcaatcacattgatgagctatgcaacgagtgcctatcgaatatgtccgttgat tgcccgaaggcttgcggggtctgccagcacgtttaccactaccattgtatttcgcgctgg ctgactaagcgtcatgtctgtcccttggactatctcgcctggcaatataaaaactga

DBGET integrated database retrieval system