Desulfomarina profundi: DGMP_00310 Help Entry DGMP_00310        CDS       T07650                                  Name (GenBank) hypothetical protein   KO K01803   triosephosphate isomerase (TIM) [EC:5.3.1.1] Organism dbk  Desulfomarina profundi Pathway dbk00010   Glycolysis / Gluconeogenesis dbk00051   Fructose and mannose metabolism dbk00562   Inositol phosphate metabolism dbk00710   Carbon fixation by Calvin cycle dbk01100   Metabolic pathways dbk01110   Biosynthesis of secondary metabolites dbk01120   Microbial metabolism in diverse environments dbk01200   Carbon metabolism dbk01230   Biosynthesis of amino acids Module dbk_M00001   Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate dbk_M00002   Glycolysis, core module involving three-carbon compounds dbk_M00003   Gluconeogenesis, oxaloacetate => fructose-6P Brite KEGG Orthology (KO) [BR:dbk00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     DGMP_00310    00051 Fructose and mannose metabolism     DGMP_00310    00562 Inositol phosphate metabolism     DGMP_00310   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     DGMP_00310  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dbk04147]     DGMP_00310 Enzymes [BR:dbk01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.1  triose-phosphate isomerase      DGMP_00310 Exosome [BR:dbk04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    DGMP_00310   Exosomal proteins of bladder cancer cells    DGMP_00310   Exosomal proteins of melanoma cells    DGMP_00310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TIM Beta-prop_WDR19_2nd YOMG_N Motif Other DBs NCBI-ProteinID:  BCL59338 UniProt:  A0A8D5FDL4 LinkDB All DBs Position 26975..27409 Genome browser AA seq 144 aa AA seqDB search MLRGLVDYVIIGHSERKRYFHETDQDIINKVNETVDAGLIPIVCVDGSSLSSRLASLQDI DIDRMIIAYTPVDALTFKIPESPEKVKETLEEKKYHLGKWPVIYGGALLASNVRDYSSLP VLSGVFVASASLDPRDFAEVCQQV NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atgttgagaggacttgttgattatgtgatcattggtcattctgagcggaaacgatatttt catgaaacggatcaggatattatcaataaggtcaatgaaacggtagatgccggtctgatt cccattgtttgcgtggacggttcttcgttatcatcacggctggcatcactacaggatatt gatattgaccggatgatcatagcatatacccctgtcgatgccctgacattcaaaatcccc gagtccccggaaaaagtgaaggaaactcttgaggaaaaaaaatatcacctggggaaatgg ccggttatttacgggggagcactgctcgcatccaatgtaagggactactcttctctcccg gtactgtccggtgtttttgtggccagtgcaagtctggatcccagggattttgccgaagtt tgtcaacaggtgtga

DBGET integrated database retrieval system