Diaphorina citri (Asian citrus psyllid): 108251859 Help Entry 108251859         CDS       T07332                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism dci  Diaphorina citri (Asian citrus psyllid) Pathway dci00510   N-Glycan biosynthesis dci00513   Various types of N-glycan biosynthesis dci04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:dci00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     108251859    00513 Various types of N-glycan biosynthesis     108251859  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108251859 SSDB OrthologParalogGFIT Motif Pfam:  Ost5 TctB Motif Other DBs NCBI-GeneID:  108251859 NCBI-ProteinID:  XP_017297772 UniProt:  A0A1S3DP14 LinkDB All DBs Position Unknown AA seq 83 aa AA seqDB search MQSTINYESMQRYVSPVNPAIFPHLTILLLGIGIFFTAWFFVYEVTSTKLSRDLVKELVI ALVAALFSGFGTLFLLLWVGIYV NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgcagtccaccatcaactacgagtcaatgcaaagatatgtgtcacctgtcaacccagcc atctttcctcacctcaccatattgctgcttggaattggaatattcttcacagcttggttc tttgtctatgaggtgaccagcacaaaactatcacgagatcttgtcaaagagttggtcata gctctggtagcagccttgttctctggttttggcacactgttcttgttactttgggtcgga atatatgtttga

DBGET integrated database retrieval system