Daucus carota (carrot): 108211059 Help Entry 108211059         CDS       T05350                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dcr  Daucus carota (carrot) Pathway dcr03420   Nucleotide excision repair dcr04120   Ubiquitin mediated proteolysis dcr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:dcr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108211059    04120 Ubiquitin mediated proteolysis     108211059   09124 Replication and repair    03420 Nucleotide excision repair     108211059  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dcr04121]     108211059    03400 DNA repair and recombination proteins [BR:dcr03400]     108211059 Enzymes [BR:dcr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      108211059 Ubiquitin system [BR:dcr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    108211059   Multi subunit type E3    SCF complex     Ring finger protein      108211059    Cul2 complex      108211059    Cul3 complex      108211059    Cul4 complex      108211059    Cul7 complex      108211059    Cul8 complex      108211059    Cul9 complex      108211059 DNA repair and recombination proteins [BR:dcr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       108211059     TCR (transcription coupled repair) factors      Cul4-CSA complex       108211059 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  108211059 NCBI-ProteinID:  XP_017238036 UniProt:  A0AAF0WNX2 LinkDB All DBs Position 3:complement(38957794..38959457) Genome browser AA seq 120 aa AA seqDB search MASVSTDVNMVSAAEASTVSTSSSSAIRKANKRLEIKKWNAVSLWAWDIVVDNCAICRNH IMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggcttctgtgagcaccgatgtgaacatggtttctgcagccgaggcttcaacggtttca acatcatcatcatctgccattagaaaagctaataagcgtttggagatcaaaaagtggaac gctgtgtctctctgggcctgggatattgtggtggataattgtgctatttgcaggaatcat atcatggatctttgtatcgagtgtcaagctaaccaagctagcgctacaagtgaggagtgc actgtggcttggggggtctgcaaccatgcatttcacttccactgcatcagtcgatggctg aaaacccgacaagtatgtccattagataacagcgaatgggaatttcagaagtacggtcat taa

DBGET integrated database retrieval system