Daucus carota (carrot): 108224330 Help Entry 108224330         CDS       T05350                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dcr  Daucus carota (carrot) Pathway dcr03420   Nucleotide excision repair dcr04120   Ubiquitin mediated proteolysis dcr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:dcr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108224330    04120 Ubiquitin mediated proteolysis     108224330   09124 Replication and repair    03420 Nucleotide excision repair     108224330  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dcr04121]     108224330    03400 DNA repair and recombination proteins [BR:dcr03400]     108224330 Enzymes [BR:dcr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      108224330 Ubiquitin system [BR:dcr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    108224330   Multi subunit type E3    SCF complex     Ring finger protein      108224330    Cul2 complex      108224330    Cul3 complex      108224330    Cul4 complex      108224330    Cul7 complex      108224330    Cul8 complex      108224330    Cul9 complex      108224330 DNA repair and recombination proteins [BR:dcr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       108224330     TCR (transcription coupled repair) factors      Cul4-CSA complex       108224330 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  108224330 NCBI-ProteinID:  XP_017254385 UniProt:  A0AAF0XBN1 LinkDB All DBs Position 6:complement(12126578..12130748) Genome browser AA seq 117 aa AA seqDB search MDTDVTMVPVEEVGSSSGAGSSSTKKAPKRFEIKKWNAVSLWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggacaccgacgtcacgatggtccccgtagaagaagtcggatccagcagcggcgccgga tcctcatcaacaaaaaaagcacccaagcgcttcgaaatcaaaaagtggaacgccgtctct ctctgggcttgggatattgttgttgataattgcgctatttgcaggaaccatatcatggat ctctgtattgagtgtcaagcgaatcaggctagcgccacgagtgaggaatgcacagttgct tggggggtgtgcaatcatgcctttcactttcactgcatcagccgatggcttaaaacgcgt caagtgtgccctctggataatagtgagtgggagttccaaaagtatggacactag

DBGET integrated database retrieval system