Dendrobium catenatum: 110100420 Help Entry 110100420         CDS       T05027                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dct  Dendrobium catenatum Pathway dct03420   Nucleotide excision repair dct04120   Ubiquitin mediated proteolysis dct04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:dct00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110100420    04120 Ubiquitin mediated proteolysis     110100420   09124 Replication and repair    03420 Nucleotide excision repair     110100420  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dct04121]     110100420    03400 DNA repair and recombination proteins [BR:dct03400]     110100420 Enzymes [BR:dct01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      110100420 Ubiquitin system [BR:dct04121]  Ubiquitin ligases (E3)   UBL E3 ligases    110100420   Multi subunit type E3    SCF complex     Ring finger protein      110100420    Cul2 complex      110100420    Cul3 complex      110100420    Cul4 complex      110100420    Cul7 complex      110100420    Cul8 complex      110100420    Cul9 complex      110100420 DNA repair and recombination proteins [BR:dct03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       110100420     TCR (transcription coupled repair) factors      Cul4-CSA complex       110100420 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  110100420 NCBI-ProteinID:  XP_020683576 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MATLDTDINMVPVGEGSSSAGPSSSRKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggcgactcttgacacagacatcaacatggttcccgtcggcgaggggtcgagcagcgca gggccgtcgtcatcaaggaagccgaagcggttcgagatcaagaaatggaatgccgtcgct ctctgggcctgggatattgtggttgataactgtgcaatttgccgaaaccacatcatggat ctatgcattgaatgtcaggccaatcaagcaagtgccacgagtgaagagtgcactgtggct tggggagtgtgcaatcatgcattccattttcactgcatcagtcggtggctcaaaacccgt caagtttgcccacttgacaacagtgaatgggagttccaaaaatatggtcattag

DBGET integrated database retrieval system