KEGG   Desulfitobacterium dichloroeliminans: Desdi_2678
Entry
Desdi_2678        CDS       T02390                                 
Name
(GenBank) 3-oxoacyl-(acyl-carrier-protein) reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
ddl00061  Fatty acid biosynthesis
ddl00780  Biotin metabolism
ddl01100  Metabolic pathways
ddl01110  Biosynthesis of secondary metabolites
ddl01212  Fatty acid metabolism
ddl01240  Biosynthesis of cofactors
Module
ddl_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ddl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Desdi_2678
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Desdi_2678
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Desdi_2678
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ddl01004]
    Desdi_2678
Enzymes [BR:ddl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     Desdi_2678
Lipid biosynthesis proteins [BR:ddl01004]
 Fatty acid synthase
  Component type
   Desdi_2678
SSDB
Motif
Pfam: adh_short_C2 adh_short KR SDR F420_oxidored Epimerase
Other DBs
NCBI-ProteinID: AGA70093
UniProt: L0FAY8
LinkDB
Position
complement(2717586..2718329)
AA seq 247 aa
MLLDNSVAIVTGGGRGIGRAIALELARAGAKVVVNYAGHAEKAEETVRFIQELGGDACAV
QADVSQSEDVERLIETTLKTFGKIDILINNAGITRDTLLLRMKEVDWDAVLDTNLKGVFL
CTKAVSKSMMKQRSGVIVNITSVVGISGNAGQANYSAAKAGIIGFTKSVAKELASRGIRV
NAVAPGYISTDMTESLAEGVKDQVLGQIPLNRMGKPEDVAQAVVFLSSPLASYVTGQILS
VDGGMAM
NT seq 744 nt   +upstreamnt  +downstreamnt
atgttgcttgataatagcgtagccatcgtgactggtggagggcgtggtatcggacgtgcc
atcgccttggagctggctcgtgcgggagctaaggtcgtggtgaattatgcaggacatgcg
gaaaaagccgaggaaaccgtgcgcttcattcaggagttgggtggagacgcttgcgcagtt
caggcagatgtcagccaaagtgaagatgtggaacgattgattgagaccacacttaaaact
tttggtaagatagatatcctaatcaataatgcgggtatcacacgcgatacattattgctc
cgcatgaaggaagtggattgggatgctgtattggatacgaatctcaaaggagtattctta
tgcaccaaggctgtcagcaaatcaatgatgaagcagcgttcaggagttatcgtcaatatc
acttctgtagtgggaattagcggtaatgccgggcaagctaattactcggcagctaaagca
ggaattatcggctttacaaagtccgtggctaaggagctggcatcccgaggaattcgagtg
aatgcagttgctccggggtatatttctacggatatgacggaatccttagcagaaggagtc
aaggatcaagtgctggggcaaatccccttaaacagaatgggtaaacccgaggacgtggcc
caagccgtggtctttttgtcctcacccttagcatcctatgtgaccggacaaattctttcc
gtcgatggcggaatggctatgtag

DBGET integrated database retrieval system