Desulfitobacterium dichloroeliminans: Desdi_2678
Help
Entry
Desdi_2678 CDS
T02390
Name
(GenBank) 3-oxoacyl-(acyl-carrier-protein) reductase
KO
K00059
3-oxoacyl-[acyl-carrier protein] reductase [EC:
1.1.1.100
]
Organism
ddl
Desulfitobacterium dichloroeliminans
Pathway
ddl00061
Fatty acid biosynthesis
ddl00780
Biotin metabolism
ddl01100
Metabolic pathways
ddl01110
Biosynthesis of secondary metabolites
ddl01212
Fatty acid metabolism
ddl01240
Biosynthesis of cofactors
Module
ddl_M00083
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:
ddl00001
]
09100 Metabolism
09103 Lipid metabolism
00061 Fatty acid biosynthesis
Desdi_2678
09108 Metabolism of cofactors and vitamins
00780 Biotin metabolism
Desdi_2678
09110 Biosynthesis of other secondary metabolites
00333 Prodigiosin biosynthesis
Desdi_2678
09180 Brite Hierarchies
09181 Protein families: metabolism
01004 Lipid biosynthesis proteins [BR:
ddl01004
]
Desdi_2678
Enzymes [BR:
ddl01000
]
1. Oxidoreductases
1.1 Acting on the CH-OH group of donors
1.1.1 With NAD+ or NADP+ as acceptor
1.1.1.100 3-oxoacyl-[acyl-carrier-protein] reductase
Desdi_2678
Lipid biosynthesis proteins [BR:
ddl01004
]
Fatty acid synthase
Component type
Desdi_2678
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
adh_short_C2
adh_short
KR
SDR
F420_oxidored
Epimerase
Motif
Other DBs
NCBI-ProteinID:
AGA70093
UniProt:
L0FAY8
LinkDB
All DBs
Position
complement(2717586..2718329)
Genome browser
AA seq
247 aa
AA seq
DB search
MLLDNSVAIVTGGGRGIGRAIALELARAGAKVVVNYAGHAEKAEETVRFIQELGGDACAV
QADVSQSEDVERLIETTLKTFGKIDILINNAGITRDTLLLRMKEVDWDAVLDTNLKGVFL
CTKAVSKSMMKQRSGVIVNITSVVGISGNAGQANYSAAKAGIIGFTKSVAKELASRGIRV
NAVAPGYISTDMTESLAEGVKDQVLGQIPLNRMGKPEDVAQAVVFLSSPLASYVTGQILS
VDGGMAM
NT seq
744 nt
NT seq
+upstream
nt +downstream
nt
atgttgcttgataatagcgtagccatcgtgactggtggagggcgtggtatcggacgtgcc
atcgccttggagctggctcgtgcgggagctaaggtcgtggtgaattatgcaggacatgcg
gaaaaagccgaggaaaccgtgcgcttcattcaggagttgggtggagacgcttgcgcagtt
caggcagatgtcagccaaagtgaagatgtggaacgattgattgagaccacacttaaaact
tttggtaagatagatatcctaatcaataatgcgggtatcacacgcgatacattattgctc
cgcatgaaggaagtggattgggatgctgtattggatacgaatctcaaaggagtattctta
tgcaccaaggctgtcagcaaatcaatgatgaagcagcgttcaggagttatcgtcaatatc
acttctgtagtgggaattagcggtaatgccgggcaagctaattactcggcagctaaagca
ggaattatcggctttacaaagtccgtggctaaggagctggcatcccgaggaattcgagtg
aatgcagttgctccggggtatatttctacggatatgacggaatccttagcagaaggagtc
aaggatcaagtgctggggcaaatccccttaaacagaatgggtaaacccgaggacgtggcc
caagccgtggtctttttgtcctcacccttagcatcctatgtgaccggacaaattctttcc
gtcgatggcggaatggctatgtag
DBGET
integrated database retrieval system